Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3111
Gene name	Major histocompatibility complex, class II, DO alpha
Gene symbol	HLA-DOA
Synonyms (NCBI Gene)	HLA-DNAHLA-DZAHLADZ
Chromosome	6
Chromosome location	6p21.32
Summary	HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with cla

319 Show/Hide all (319)

miRTarBase ID	miRNA	Experiments	Reference
MIRT491507	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT491505	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT491503	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491504	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491502	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491501	hsa-miR-5194	PAR-CLIP	23592263
MIRT491499	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491500	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT491498	hsa-miR-7704	PAR-CLIP	23592263
MIRT491496	hsa-miR-3915	PAR-CLIP	23592263
MIRT491497	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT450608	hsa-miR-130b-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT491507	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT491505	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT491503	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491504	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491502	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491501	hsa-miR-5194	PAR-CLIP	23592263
MIRT491499	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491500	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT491498	hsa-miR-7704	PAR-CLIP	23592263
MIRT491496	hsa-miR-3915	PAR-CLIP	23592263
MIRT491497	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT450608	hsa-miR-130b-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT1048296	hsa-miR-1202	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048298	hsa-miR-1272	CLIP-seq
MIRT1048299	hsa-miR-1273f	CLIP-seq
MIRT1048300	hsa-miR-135a	CLIP-seq
MIRT1048301	hsa-miR-135b	CLIP-seq
MIRT1048302	hsa-miR-143	CLIP-seq
MIRT1048303	hsa-miR-1827	CLIP-seq
MIRT1048304	hsa-miR-1972	CLIP-seq
MIRT1048305	hsa-miR-2114	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT1048307	hsa-miR-3130-3p	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048309	hsa-miR-3152-5p	CLIP-seq
MIRT1048310	hsa-miR-3180-5p	CLIP-seq
MIRT1048311	hsa-miR-3194-5p	CLIP-seq
MIRT1048312	hsa-miR-3202	CLIP-seq
MIRT1048313	hsa-miR-325	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048315	hsa-miR-3591-5p	CLIP-seq
MIRT1048316	hsa-miR-3614-3p	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT1048318	hsa-miR-3664-3p	CLIP-seq
MIRT1048319	hsa-miR-3667-3p	CLIP-seq
MIRT1048320	hsa-miR-3668	CLIP-seq
MIRT1048321	hsa-miR-3674	CLIP-seq
MIRT1048322	hsa-miR-3689d	CLIP-seq
MIRT1048323	hsa-miR-384	CLIP-seq
MIRT1048324	hsa-miR-3926	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048326	hsa-miR-3972	CLIP-seq
MIRT1048327	hsa-miR-4252	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT1048329	hsa-miR-4297	CLIP-seq
MIRT1048330	hsa-miR-4299	CLIP-seq
MIRT1048331	hsa-miR-4324	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048334	hsa-miR-4431	CLIP-seq
MIRT1048335	hsa-miR-4433	CLIP-seq
MIRT1048336	hsa-miR-4446-3p	CLIP-seq
MIRT1048337	hsa-miR-4459	CLIP-seq
MIRT1048338	hsa-miR-4473	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT1048340	hsa-miR-4492	CLIP-seq
MIRT1048341	hsa-miR-4498	CLIP-seq
MIRT1048342	hsa-miR-4505	CLIP-seq
MIRT1048343	hsa-miR-4529-5p	CLIP-seq
MIRT1048344	hsa-miR-4649-3p	CLIP-seq
MIRT1048345	hsa-miR-4671-3p	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT1048347	hsa-miR-4695-5p	CLIP-seq
MIRT1048348	hsa-miR-4708-5p	CLIP-seq
MIRT1048349	hsa-miR-4722-5p	CLIP-seq
MIRT1048350	hsa-miR-4726-3p	CLIP-seq
MIRT1048351	hsa-miR-4732-5p	CLIP-seq
MIRT1048352	hsa-miR-4733-3p	CLIP-seq
MIRT1048353	hsa-miR-4747-5p	CLIP-seq
MIRT1048354	hsa-miR-4768-3p	CLIP-seq
MIRT1048355	hsa-miR-4770	CLIP-seq
MIRT1048356	hsa-miR-4774-3p	CLIP-seq
MIRT1048357	hsa-miR-4786-5p	CLIP-seq
MIRT1048358	hsa-miR-4790-3p	CLIP-seq
MIRT1048359	hsa-miR-4793-5p	CLIP-seq
MIRT1048360	hsa-miR-4797-5p	CLIP-seq
MIRT1048361	hsa-miR-485-5p	CLIP-seq
MIRT1048362	hsa-miR-508-5p	CLIP-seq
MIRT1048363	hsa-miR-510	CLIP-seq
MIRT1048364	hsa-miR-512-3p	CLIP-seq
MIRT1048365	hsa-miR-512-5p	CLIP-seq
MIRT1048366	hsa-miR-520f	CLIP-seq
MIRT1048367	hsa-miR-542-3p	CLIP-seq
MIRT1048368	hsa-miR-548s	CLIP-seq
MIRT1048369	hsa-miR-554	CLIP-seq
MIRT1048370	hsa-miR-561	CLIP-seq
MIRT1048371	hsa-miR-615-5p	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT1048373	hsa-miR-665	CLIP-seq
MIRT1048374	hsa-miR-759	CLIP-seq
MIRT1048375	hsa-miR-762	CLIP-seq
MIRT1048376	hsa-miR-766	CLIP-seq
MIRT1048377	hsa-miR-767-5p	CLIP-seq
MIRT1048378	hsa-miR-769-5p	CLIP-seq
MIRT1048379	hsa-miR-940	CLIP-seq
MIRT1549532	hsa-miR-1910	CLIP-seq
MIRT1549533	hsa-miR-4421	CLIP-seq
MIRT1549534	hsa-miR-4757-5p	CLIP-seq
MIRT2010991	hsa-miR-1184	CLIP-seq
MIRT1048299	hsa-miR-1273f	CLIP-seq
MIRT2010992	hsa-miR-1343	CLIP-seq
MIRT2010993	hsa-miR-145	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT2010994	hsa-miR-3122	CLIP-seq
MIRT1048310	hsa-miR-3180-5p	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2010995	hsa-miR-3689a-3p	CLIP-seq
MIRT2010996	hsa-miR-3689c	CLIP-seq
MIRT2010997	hsa-miR-378g	CLIP-seq
MIRT2010998	hsa-miR-3913-5p	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT2010999	hsa-miR-4418	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT2011000	hsa-miR-4437	CLIP-seq
MIRT1048342	hsa-miR-4505	CLIP-seq
MIRT2011001	hsa-miR-4674	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT2011002	hsa-miR-4712-5p	CLIP-seq
MIRT1048353	hsa-miR-4747-5p	CLIP-seq
MIRT2011003	hsa-miR-509-3-5p	CLIP-seq
MIRT2011004	hsa-miR-509-5p	CLIP-seq
MIRT1048368	hsa-miR-548s	CLIP-seq
MIRT2011005	hsa-miR-770-5p	CLIP-seq
MIRT2010991	hsa-miR-1184	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT2243257	hsa-miR-1228	CLIP-seq
MIRT1048299	hsa-miR-1273f	CLIP-seq
MIRT2010992	hsa-miR-1343	CLIP-seq
MIRT1048300	hsa-miR-135a	CLIP-seq
MIRT1048301	hsa-miR-135b	CLIP-seq
MIRT2243258	hsa-miR-142-3p	CLIP-seq
MIRT1048302	hsa-miR-143	CLIP-seq
MIRT2010993	hsa-miR-145	CLIP-seq
MIRT1048303	hsa-miR-1827	CLIP-seq
MIRT1048305	hsa-miR-2114	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT2243259	hsa-miR-296-3p	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT2243260	hsa-miR-3160-3p	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT1048318	hsa-miR-3664-3p	CLIP-seq
MIRT2243261	hsa-miR-3664-5p	CLIP-seq
MIRT2243262	hsa-miR-3677-5p	CLIP-seq
MIRT2243263	hsa-miR-3682-3p	CLIP-seq
MIRT2010995	hsa-miR-3689a-3p	CLIP-seq
MIRT2010996	hsa-miR-3689c	CLIP-seq
MIRT1048322	hsa-miR-3689d	CLIP-seq
MIRT2010997	hsa-miR-378g	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT2243264	hsa-miR-4280	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT2010999	hsa-miR-4418	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048335	hsa-miR-4433	CLIP-seq
MIRT2011000	hsa-miR-4437	CLIP-seq
MIRT1048337	hsa-miR-4459	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT2243265	hsa-miR-4487	CLIP-seq
MIRT2243266	hsa-miR-4639-3p	CLIP-seq
MIRT1048344	hsa-miR-4649-3p	CLIP-seq
MIRT2243267	hsa-miR-4652-3p	CLIP-seq
MIRT2011001	hsa-miR-4674	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT1048347	hsa-miR-4695-5p	CLIP-seq
MIRT1048348	hsa-miR-4708-5p	CLIP-seq
MIRT2011002	hsa-miR-4712-5p	CLIP-seq
MIRT1048349	hsa-miR-4722-5p	CLIP-seq
MIRT2243268	hsa-miR-4728-5p	CLIP-seq
MIRT1048354	hsa-miR-4768-3p	CLIP-seq
MIRT1048355	hsa-miR-4770	CLIP-seq
MIRT1048361	hsa-miR-485-5p	CLIP-seq
MIRT2011003	hsa-miR-509-3-5p	CLIP-seq
MIRT2011004	hsa-miR-509-5p	CLIP-seq
MIRT1048363	hsa-miR-510	CLIP-seq
MIRT1048365	hsa-miR-512-5p	CLIP-seq
MIRT2243269	hsa-miR-558	CLIP-seq
MIRT2243270	hsa-miR-598	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT2011005	hsa-miR-770-5p	CLIP-seq
MIRT2243271	hsa-miR-935	CLIP-seq
MIRT1048379	hsa-miR-940	CLIP-seq
MIRT2010991	hsa-miR-1184	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT1048310	hsa-miR-3180-5p	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT2010999	hsa-miR-4418	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT2011003	hsa-miR-509-3-5p	CLIP-seq
MIRT2011004	hsa-miR-509-5p	CLIP-seq
MIRT2451234	hsa-miR-1182	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2243261	hsa-miR-3664-5p	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT2243266	hsa-miR-4639-3p	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048298	hsa-miR-1272	CLIP-seq
MIRT2546435	hsa-miR-2277-3p	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2546436	hsa-miR-3662	CLIP-seq
MIRT1048324	hsa-miR-3926	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT1048343	hsa-miR-4529-5p	CLIP-seq
MIRT2546437	hsa-miR-4638-5p	CLIP-seq
MIRT2546438	hsa-miR-4684-5p	CLIP-seq
MIRT1048359	hsa-miR-4793-5p	CLIP-seq
MIRT2546439	hsa-miR-548c-3p	CLIP-seq
MIRT1048368	hsa-miR-548s	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048298	hsa-miR-1272	CLIP-seq
MIRT2546435	hsa-miR-2277-3p	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2546436	hsa-miR-3662	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT2546437	hsa-miR-4638-5p	CLIP-seq
MIRT2546438	hsa-miR-4684-5p	CLIP-seq
MIRT2546439	hsa-miR-548c-3p	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq

Transcription factor	Regulation	Reference
CIITA	Activation	11823510
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

30 Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0002587	Process	Negative regulation of antigen processing and presentation of peptide antigen via MHC class II	IDA	22733780
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	TAS	3000765
GO:0006955	Process	Immune response	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0023026	Function	MHC class II protein complex binding	IDA	22733780
GO:0031902	Component	Late endosome membrane	IBA
GO:0032395	Function	MHC class II receptor activity	TAS	3000765
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	22733780
GO:0042613	Component	MHC class II protein complex	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA

MIM	HGNC	e!Ensembl
142930	4936	ENSG00000204252

P06340

Protein name

HLA class II histocompatibility antigen, DO alpha chain (MHC DN-alpha) (MHC DZ alpha) (MHC class II antigen DOA)

Protein function

Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM.

PDB

4I0P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00993	MHC_II_alpha	29 → 109	Class II histocompatibility antigen, alpha domain	Domain
PF07654	C1-set	115 → 196	Immunoglobulin C1-set domain	Domain

Sequence

MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR

Sequence length

250

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Phagosome	MHC class II antigen presentation
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (32)
ASTHMA	—	GWAS catalog	21804548, 31619474, 31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	28540026	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	32534018	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC INTERSTITIAL CYSTITIS	—	GWAS catalog	39620209	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	38368726	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	37377963	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	31174203	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	37377963	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	27089181	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	32141793	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	37247657	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	24024966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	29892016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	29892016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	29892016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	38757301, 39789286, 39885523	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	36762574, 37377963, 38368726, 39620209	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	28540026	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	36828809	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	32771030, 36762574	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	37377963	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (104)
Addison Disease	Addison`s Disease	BEFREE	15240634, 9398726	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	27210825	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	31580408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28705838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	2902225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	12917841	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27600773	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12114354	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	21716163	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	12873588, 23551963, 31298041	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	12439622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15592805, 16189655, 20138855, 28532625, 3014346	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23829277, 31580408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11205913, 24014088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	23900675, 27644617	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15218356, 16527605, 27304060, 28097051, 29118259	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	12114354	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11205913, 24014088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29033936	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19117353	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	7879822	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	19107404, 24201079	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19107404, 24201079	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19245431	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1339304	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29970719	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	6318983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	3017844	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	29660300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	20626023	★★★★★ ★☆☆☆☆ Found in Text Mining only
CTLA4 Haploinsufficiency	CTLA4 deficiency	BEFREE	30377434	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16461143, 29660300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11894970, 19949652, 20610662, 22218756, 23261825, 24465825, 25185645, 2801776, 3417056	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11886709	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	25185645	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	16121403	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	27671914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16461143, 29660300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	7779117	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrokeratoderma	Erythrokeratoderma	BEFREE	20854438	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31424306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31424306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	22905924, 23480667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	8488546	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10369864, 12097196, 14570752, 18059468, 22218756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	19240270	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	14570752	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31580408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	7997453, 92196	★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	92196	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	29660300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	21034161, 30319055	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27965521	★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	16206510, 19332045	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1709379	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16908353	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19778566, 30539855	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16735466, 27894401, 28463775	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	27644617	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15218356, 16527605, 27304060, 28097051, 29118259	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31424306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29033936	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19117353	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22011251	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15695002, 16541432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11205913, 24014088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12439622, 18757416, 19638588, 20920330, 21387262, 23656731, 23701182, 23745791, 24307627, 24493286, 24934372, 27498821, 28532625, 29033936, 29980467, 30873379, 31068932, 31555274 View all (3 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19107404, 24201079	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23709751, 27628745, 29118259, 29707161	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	20854438	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	25207460, 25922203, 27590328, 29033936, 29948466, 30488824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20626023	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14616291, 18256983, 23039885, 72803	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	BEFREE	22218756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9523228	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19922464	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14616291, 18629495, 19107404, 19752747, 24728075, 28084572, 28705838, 29118259, 29682176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	27424137	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29100337, 30612418	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21453059, 21612409, 25000484, 25230787	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19117353	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22011251	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	27210825	★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	1420116	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	20557968, 22118691, 23432218, 28642883	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	1420116	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26013045, 8178173	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	29850619	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15546339, 19741715, 27486778, 2898314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	15881277	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	11261326	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27354668	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	25922203	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15695002, 16541432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16189655	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31580408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	9951811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25615025	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19089435	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	10215771, 26013045	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	10215771, 26013045	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HLA-DPA1	6	["Autoimmune disease","Celiac disease","Interstitial cystitis","Keratinocyte carcinoma","Non-melanoma skin carcinoma","Ocular sarcoidosis"]	25	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	7	["Disgenet (Asthma)","GWAS catalog (Autoimmune disease)","GWAS catalog (Celiac disease)","GWAS catalog (Interstitial cystitis)","GWAS catalog (Keratinocyte carcinoma)","GWAS catalog (Non-melanoma skin carcinoma)","GWAS catalog (Ocular sarcoidosis)"]
HLA-DOB	3	["Celiac disease","Interstitial cystitis","Sclerosing cholangitis"]	25	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	3	["GWAS catalog (Celiac disease)","GWAS catalog (Interstitial cystitis)","GWAS catalog (Sclerosing cholangitis)"]
HLA-DQB2	3	["Celiac disease","Interstitial cystitis","Sclerosing cholangitis"]	25	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	3	["GWAS catalog (Celiac disease)","GWAS catalog (Interstitial cystitis)","GWAS catalog (Sclerosing cholangitis)"]
HLA-DRA	3	["Celiac disease","Interstitial cystitis","Sclerosing cholangitis"]	25	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	4	["Disgenet (Asthma)","GWAS catalog (Celiac disease)","GWAS catalog (Interstitial cystitis)","GWAS catalog (Sclerosing cholangitis)"]
HLA-DMB	1	["Autoimmune disease"]	25	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	1	["GWAS catalog (Autoimmune disease)"]

HLA-DOA (major histocompatibility complex, class II, DO alpha)

Bookmark This Gene