HINT2 (histidine triad nucleotide binding protein 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 84681
• Gene name: Histidine triad nucleotide binding protein 2
• Gene symbol: HINT2
• Synonyms (NCBI Gene): HIT-17
• Chromosome: 9
• Chromosome location: 9p13.3
• Summary: Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023774	hsa-miR-1-3p	Proteomics	18668040
MIRT1046082	hsa-miR-204	CLIP-seq
MIRT1046083	hsa-miR-211	CLIP-seq
MIRT1046084	hsa-miR-4299	CLIP-seq
MIRT1046085	hsa-miR-4328	CLIP-seq
MIRT1046086	hsa-miR-4446-5p	CLIP-seq
MIRT1046087	hsa-miR-4456	CLIP-seq
MIRT1046088	hsa-miR-4475	CLIP-seq
MIRT1046089	hsa-miR-4755-5p	CLIP-seq
MIRT1046090	hsa-miR-4773	CLIP-seq
MIRT1046091	hsa-miR-513a-5p	CLIP-seq
MIRT1046092	hsa-miR-520a-5p	CLIP-seq
MIRT1046093	hsa-miR-525-5p	CLIP-seq
MIRT1046094	hsa-miR-548q	CLIP-seq
MIRT1046095	hsa-miR-587	CLIP-seq
MIRT1046096	hsa-miR-623	CLIP-seq
MIRT1046085	hsa-miR-4328	CLIP-seq
MIRT1046090	hsa-miR-4773	CLIP-seq
MIRT1046091	hsa-miR-513a-5p	CLIP-seq
MIRT1046095	hsa-miR-587	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0005515	Function	Protein binding	IPI	35156780
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	16762638
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0043530	Function	Adenosine 5'-monophosphoramidase activity	IDA	16762638, 31990367
GO:0043530	Function	Adenosine 5'-monophosphoramidase activity	IEA

Other IDs

• MIM: 609997
• HGNC: 18344
• e!Ensembl: ENSG00000137133

Protein

• UniProt ID: Q9BX68
• Protein name: Adenosine 5'-monophosphoramidase HINT2 (EC 3.9.1.-) (HINT-3) (HIT-17kDa) (Histidine triad nucleotide-binding protein 2, mitochondrial) (HINT-2) (PKCI-1-related HIT protein)
• Protein function: Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed:16762638, PubMed:31990367). Hydrolyze
• PDB: 4INC , 4INI , 5KM5 , 5KM8 , 5KM9 , 6YI0 , 6YPR , 6YPX , 6YQD , 6YVP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01230	HIT	61 → 158	HIT domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: High expression in liver and pancreas. Expression is significantly down-regulated in hepatocellular carcinoma (HCC) patients. {ECO:0000269|PubMed:16762638}.
• Sequence:

  MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRIL
  DKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQ
  TAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG

• Sequence length: 163

Related Genes

No strongly related genes found yet for HINT2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to HINT2.