HIGD2B (HIG1 hypoxia inducible domain family member 2B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 123346
Gene name HIG1 hypoxia inducible domain family member 2B
Gene symbol HIGD2B
Synonyms (NCBI Gene)
HIGD2BP
Chromosome 15
Chromosome location 15q24.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005739 Component Mitochondrion IBA
GO:0016020 Component Membrane IEA
GO:0097250 Process Mitochondrial respirasome assembly IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q4VC39
Protein name HIG1 domain family member 2B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04588 HIG_1_N 45 → 96 Hypoxia induced protein conserved region Family
Sequence 
MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENPVVPIGFLCTAAVL
TNGLYCFHQGNSQCSRLMMHTQIAAQGFTIAAILLGLAATAMKSPP
Sequence length 106
Interactions View interactions

No strongly related genes found yet for HIGD2B.

No additional diseases found yet through genes similar to HIGD2B.