HIGD1B (HIG1 hypoxia inducible domain family member 1B)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51751
Gene name HIG1 hypoxia inducible domain family member 1B
Gene symbol HIGD1B
Synonyms (NCBI Gene)
CLST11240CLST11240-15
Chromosome 17
Chromosome location 17q21.31
Summary This gene encodes a member of the hypoxia inducible gene 1 (HIG1) domain family. The encoded protein is localized to the cell membrane and has been linked to tumorigenesis and the progression of pituitary adenomas. Alternative splicing results in multiple
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IBA
GO:0016020 Component Membrane IEA
GO:0097250 Process Mitochondrial respirasome assembly IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620420 24318 ENSG00000131097
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P298
Protein name HIG1 domain family member 1B (Protein CLST 11240)
PDB 2LON
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04588 HIG_1_N 27 → 79 Hypoxia induced protein conserved region Family
Sequence 
MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIH
LIHTRVAAQACAVGAIMLGAVYTMYSDYVKRMAQDAGEK
Sequence length 99
Interactions View interactions

No strongly related genes found yet for HIGD1B.

No additional diseases found yet through genes similar to HIGD1B.