Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9146
Gene name	Hepatocyte growth factor-regulated tyrosine kinase substrate
Gene symbol	HGS
Synonyms (NCBI Gene)	HRS
Chromosome	17
Chromosome location	17q25.3
Summary	The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these prot

176 Show/Hide all (176)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004900	hsa-miR-296-5p	Luciferase reporter assayWestern blot	18977327
MIRT004900	hsa-miR-296-5p	Luciferase reporter assayWestern blot	18977327
MIRT004900	hsa-miR-296-5p	Luciferase reporter assayWestern blot	18977327
MIRT004900	hsa-miR-296-5p	Luciferase reporter assayWestern blot	18977327
MIRT052221	hsa-let-7b-5p	CLASH	23622248
MIRT042598	hsa-miR-423-3p	CLASH	23622248
MIRT037009	hsa-miR-877-3p	CLASH	23622248
MIRT375956	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT375956	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT004900	hsa-miR-296-5p	qRT-PCRWestern blot	26500043
MIRT1044902	hsa-miR-297	CLIP-seq
MIRT1044903	hsa-miR-3545-3p	CLIP-seq
MIRT1044904	hsa-miR-3668	CLIP-seq
MIRT1044905	hsa-miR-3687	CLIP-seq
MIRT1044906	hsa-miR-3934	CLIP-seq
MIRT1044907	hsa-miR-4255	CLIP-seq
MIRT1044908	hsa-miR-4442	CLIP-seq
MIRT1044909	hsa-miR-567	CLIP-seq
MIRT1044906	hsa-miR-3934	CLIP-seq
MIRT2009790	hsa-miR-1225-3p	CLIP-seq
MIRT2009791	hsa-miR-1253	CLIP-seq
MIRT2009792	hsa-miR-1270	CLIP-seq
MIRT2009793	hsa-miR-1273f	CLIP-seq
MIRT2009794	hsa-miR-2467-3p	CLIP-seq
MIRT2009795	hsa-miR-3117-5p	CLIP-seq
MIRT2009796	hsa-miR-3135b	CLIP-seq
MIRT2009797	hsa-miR-3154	CLIP-seq
MIRT2009798	hsa-miR-3170	CLIP-seq
MIRT2009799	hsa-miR-320e	CLIP-seq
MIRT2009800	hsa-miR-342-5p	CLIP-seq
MIRT2009801	hsa-miR-3678-3p	CLIP-seq
MIRT2009802	hsa-miR-3689d	CLIP-seq
MIRT2009803	hsa-miR-3919	CLIP-seq
MIRT2009804	hsa-miR-4251	CLIP-seq
MIRT2009805	hsa-miR-4323	CLIP-seq
MIRT2009806	hsa-miR-4417	CLIP-seq
MIRT2009807	hsa-miR-4419a	CLIP-seq
MIRT2009808	hsa-miR-4474-3p	CLIP-seq
MIRT2009809	hsa-miR-4475	CLIP-seq
MIRT2009810	hsa-miR-4510	CLIP-seq
MIRT2009811	hsa-miR-4651	CLIP-seq
MIRT2009812	hsa-miR-4664-5p	CLIP-seq
MIRT2009813	hsa-miR-4683	CLIP-seq
MIRT2009814	hsa-miR-4687-3p	CLIP-seq
MIRT2009815	hsa-miR-4786-3p	CLIP-seq
MIRT2009816	hsa-miR-541	CLIP-seq
MIRT2009817	hsa-miR-608	CLIP-seq
MIRT2009818	hsa-miR-620	CLIP-seq
MIRT2009819	hsa-miR-647	CLIP-seq
MIRT2009820	hsa-miR-654-5p	CLIP-seq
MIRT2009821	hsa-miR-769-5p	CLIP-seq
MIRT2009822	hsa-miR-877	CLIP-seq
MIRT2009823	hsa-miR-885-3p	CLIP-seq
MIRT1044904	hsa-miR-3668	CLIP-seq
MIRT1044907	hsa-miR-4255	CLIP-seq
MIRT2451141	hsa-miR-1224-5p	CLIP-seq
MIRT2451142	hsa-miR-1266	CLIP-seq
MIRT2451143	hsa-miR-1288	CLIP-seq
MIRT2451144	hsa-miR-2110	CLIP-seq
MIRT2451145	hsa-miR-3153	CLIP-seq
MIRT2451146	hsa-miR-3192	CLIP-seq
MIRT2451147	hsa-miR-3199	CLIP-seq
MIRT2451148	hsa-miR-331-3p	CLIP-seq
MIRT2009802	hsa-miR-3689d	CLIP-seq
MIRT2451149	hsa-miR-3929	CLIP-seq
MIRT2451150	hsa-miR-4271	CLIP-seq
MIRT2451151	hsa-miR-4292	CLIP-seq
MIRT2009806	hsa-miR-4417	CLIP-seq
MIRT2451152	hsa-miR-4418	CLIP-seq
MIRT2451153	hsa-miR-4419b	CLIP-seq
MIRT2451154	hsa-miR-4446-3p	CLIP-seq
MIRT2451155	hsa-miR-4478	CLIP-seq
MIRT2451156	hsa-miR-4488	CLIP-seq
MIRT2451157	hsa-miR-4492	CLIP-seq
MIRT2451158	hsa-miR-4498	CLIP-seq
MIRT2451159	hsa-miR-4505	CLIP-seq
MIRT2451160	hsa-miR-4518	CLIP-seq
MIRT2451161	hsa-miR-4667-5p	CLIP-seq
MIRT2451162	hsa-miR-4697-5p	CLIP-seq
MIRT2451163	hsa-miR-4700-5p	CLIP-seq
MIRT2451164	hsa-miR-4725-3p	CLIP-seq
MIRT2451165	hsa-miR-4731-5p	CLIP-seq
MIRT2451166	hsa-miR-4751	CLIP-seq
MIRT2451167	hsa-miR-509-3-5p	CLIP-seq
MIRT2451168	hsa-miR-509-5p	CLIP-seq
MIRT2451169	hsa-miR-510	CLIP-seq
MIRT2009816	hsa-miR-541	CLIP-seq
MIRT2451170	hsa-miR-637	CLIP-seq
MIRT2009820	hsa-miR-654-5p	CLIP-seq
MIRT2451171	hsa-miR-762	CLIP-seq
MIRT2451141	hsa-miR-1224-5p	CLIP-seq
MIRT2451142	hsa-miR-1266	CLIP-seq
MIRT2451143	hsa-miR-1288	CLIP-seq
MIRT2545817	hsa-miR-1470	CLIP-seq
MIRT2009797	hsa-miR-3154	CLIP-seq
MIRT2009798	hsa-miR-3170	CLIP-seq
MIRT2451146	hsa-miR-3192	CLIP-seq
MIRT2451147	hsa-miR-3199	CLIP-seq
MIRT2451148	hsa-miR-331-3p	CLIP-seq
MIRT2545818	hsa-miR-342-3p	CLIP-seq
MIRT2009800	hsa-miR-342-5p	CLIP-seq
MIRT2545819	hsa-miR-3667-3p	CLIP-seq
MIRT2009802	hsa-miR-3689d	CLIP-seq
MIRT2009803	hsa-miR-3919	CLIP-seq
MIRT2451149	hsa-miR-3929	CLIP-seq
MIRT2451151	hsa-miR-4292	CLIP-seq
MIRT2009806	hsa-miR-4417	CLIP-seq
MIRT2451152	hsa-miR-4418	CLIP-seq
MIRT2451153	hsa-miR-4419b	CLIP-seq
MIRT2451154	hsa-miR-4446-3p	CLIP-seq
MIRT2451155	hsa-miR-4478	CLIP-seq
MIRT2451156	hsa-miR-4488	CLIP-seq
MIRT2451157	hsa-miR-4492	CLIP-seq
MIRT2545820	hsa-miR-4493	CLIP-seq
MIRT2451158	hsa-miR-4498	CLIP-seq
MIRT2451159	hsa-miR-4505	CLIP-seq
MIRT2451160	hsa-miR-4518	CLIP-seq
MIRT2009811	hsa-miR-4651	CLIP-seq
MIRT2009812	hsa-miR-4664-5p	CLIP-seq
MIRT2545821	hsa-miR-4667-3p	CLIP-seq
MIRT2451162	hsa-miR-4697-5p	CLIP-seq
MIRT2545822	hsa-miR-4715-3p	CLIP-seq
MIRT2451165	hsa-miR-4731-5p	CLIP-seq
MIRT2451166	hsa-miR-4751	CLIP-seq
MIRT2451167	hsa-miR-509-3-5p	CLIP-seq
MIRT2451168	hsa-miR-509-5p	CLIP-seq
MIRT2451169	hsa-miR-510	CLIP-seq
MIRT2009816	hsa-miR-541	CLIP-seq
MIRT2545823	hsa-miR-591	CLIP-seq
MIRT2009817	hsa-miR-608	CLIP-seq
MIRT2451170	hsa-miR-637	CLIP-seq
MIRT2545824	hsa-miR-642a	CLIP-seq
MIRT2009820	hsa-miR-654-5p	CLIP-seq
MIRT2451171	hsa-miR-762	CLIP-seq
MIRT2009822	hsa-miR-877	CLIP-seq
MIRT2451141	hsa-miR-1224-5p	CLIP-seq
MIRT2451142	hsa-miR-1266	CLIP-seq
MIRT2451143	hsa-miR-1288	CLIP-seq
MIRT2009797	hsa-miR-3154	CLIP-seq
MIRT2009798	hsa-miR-3170	CLIP-seq
MIRT2451146	hsa-miR-3192	CLIP-seq
MIRT2451147	hsa-miR-3199	CLIP-seq
MIRT2451148	hsa-miR-331-3p	CLIP-seq
MIRT2545818	hsa-miR-342-3p	CLIP-seq
MIRT2009800	hsa-miR-342-5p	CLIP-seq
MIRT2009802	hsa-miR-3689d	CLIP-seq
MIRT2009803	hsa-miR-3919	CLIP-seq
MIRT2451149	hsa-miR-3929	CLIP-seq
MIRT2451151	hsa-miR-4292	CLIP-seq
MIRT2009806	hsa-miR-4417	CLIP-seq
MIRT2451152	hsa-miR-4418	CLIP-seq
MIRT2451153	hsa-miR-4419b	CLIP-seq
MIRT2451154	hsa-miR-4446-3p	CLIP-seq
MIRT2009809	hsa-miR-4475	CLIP-seq
MIRT2451155	hsa-miR-4478	CLIP-seq
MIRT2451156	hsa-miR-4488	CLIP-seq
MIRT2451157	hsa-miR-4492	CLIP-seq
MIRT2545820	hsa-miR-4493	CLIP-seq
MIRT2451158	hsa-miR-4498	CLIP-seq
MIRT2451159	hsa-miR-4505	CLIP-seq
MIRT2451160	hsa-miR-4518	CLIP-seq
MIRT2009811	hsa-miR-4651	CLIP-seq
MIRT2009812	hsa-miR-4664-5p	CLIP-seq
MIRT2451162	hsa-miR-4697-5p	CLIP-seq
MIRT2545822	hsa-miR-4715-3p	CLIP-seq
MIRT2451165	hsa-miR-4731-5p	CLIP-seq
MIRT2451166	hsa-miR-4751	CLIP-seq
MIRT2451167	hsa-miR-509-3-5p	CLIP-seq
MIRT2451168	hsa-miR-509-5p	CLIP-seq
MIRT2451169	hsa-miR-510	CLIP-seq
MIRT2009816	hsa-miR-541	CLIP-seq
MIRT2545823	hsa-miR-591	CLIP-seq
MIRT2009817	hsa-miR-608	CLIP-seq
MIRT2451170	hsa-miR-637	CLIP-seq
MIRT2009820	hsa-miR-654-5p	CLIP-seq
MIRT2451171	hsa-miR-762	CLIP-seq

48 Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10861283, 11779178, 12802020, 15611048, 16084064, 16189514, 17853893, 18675823, 19278655, 20150893, 21070952, 22046132, 22458338, 24790097, 25416956, 25588945, 25910212, 26871637, 29892012, 29997244, 31467278, 31515488, 32296183, 32814053, 33961781, 35271311, 37398436
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA
GO:0005768	Component	Endosome	IDA	15611048
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	10861283
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006622	Process	Protein targeting to lysosome	IMP	18767904
GO:0007165	Process	Signal transduction	TAS	9407053
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9407053
GO:0010324	Process	Membrane invagination	IMP	18767904
GO:0010628	Process	Positive regulation of gene expression	IMP	18767904
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IMP	18977327
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	NAS	10861283
GO:0016236	Process	Macroautophagy	IEA
GO:0016236	Process	Macroautophagy	TAS	20588296
GO:0016525	Process	Negative regulation of angiogenesis	IMP	18977327
GO:0019904	Function	Protein domain specific binding	IPI	11984006
GO:0030948	Process	Negative regulation of vascular endothelial growth factor receptor signaling pathway	IMP	18977327
GO:0031623	Process	Receptor internalization	IBA
GO:0031901	Component	Early endosome membrane	IEA
GO:0032456	Process	Endocytic recycling	IBA
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0033565	Component	ESCRT-0 complex	IDA	24790097
GO:0033565	Component	ESCRT-0 complex	IPI	19278655
GO:0033565	Component	ESCRT-0 complex	ISS
GO:0033565	Component	ESCRT-0 complex	TAS	20588296
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0036258	Process	Multivesicular body assembly	NAS	19278655
GO:0036258	Process	Multivesicular body assembly	TAS	20588296
GO:0042176	Process	Regulation of protein catabolic process	TAS	15611048
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043130	Function	Ubiquitin binding	IEA
GO:0043328	Process	Protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	NAS	19278655
GO:0043405	Process	Regulation of MAP kinase activity	IMP	17714434
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	24790097
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IDA	12444102
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072657	Process	Protein localization to membrane	IMP	18767904
GO:0090148	Process	Membrane fission	NAS	19278655
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:1903543	Process	Positive regulation of exosomal secretion	IMP	24105262

MIM	HGNC	e!Ensembl
604375	4897	ENSG00000185359

O14964

Protein name

Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)

Protein function

Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via

PDB

2D3G , 3F1I , 3OBQ , 3ZYQ , 4AVX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00790	VHS	3 → 139	VHS domain	Domain
PF01363	FYVE	158 → 221	FYVE zinc finger	Domain
PF12210	Hrs_helical	407 → 501	Hepatocyte growth factor-regulated tyrosine kinase substrate	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous expression in adult and fetal tissues with higher expression in testis and peripheral blood leukocytes. {ECO:0000269|PubMed:9407053, ECO:0000269|PubMed:9630564}.

Sequence

MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASS
APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDA
RGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQE
KERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE
GSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAY
SSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPS
QDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD

Sequence length

777

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Viral life cycle - HIV-1	EGFR downregulation
Endocytosis	Lysosome Vesicle Biogenesis
Phagosome	Ub-specific processing proteases
	Negative regulation of MET activity
	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis
	Endosomal Sorting Complex Required For Transport (ESCRT)
	Inhibition of membrane repair
	Prevention of phagosomal-lysosomal fusion

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (59)
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	29303765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16832584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	16832584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12594818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24439028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28100959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	6241212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24439028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24439028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29506740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26215675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29891722, 38608999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	24200848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26715116, 29042578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23880140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31078652, 31676023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31221000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14555530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17148761, 19424623, 26715116, 27312428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27312428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital long QT syndrome	Congenital Long QT Syndrome	BEFREE	24200848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27600398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26079416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31768550, 6241212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28748382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28143555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31777896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23880140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27600398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	26715116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	29303765, 29668606, 30871566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12594818, 1692251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20675381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28844314, 29303765, 30606404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liddle Syndrome	Liddle Syndrome	BEFREE	20675381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31743810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29303765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40311306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16098063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	24439028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26215675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26715116, 29042578, 31743810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17545595, 24743243, 26530441, 26715116, 29932968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16352611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31768550, 6241212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16638930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	9287147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12444101, 12444102, 12594818, 1692251, 17148761, 23880140, 26015570		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	18675823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	11285248, 12444101, 12444102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	12444102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22990745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	12444102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	19755917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30456986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	26079416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30871566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia, Childhood	Schizophrenia	CLINVAR_DG	26508570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25928379		★★★★★ ★☆☆☆☆ Found in Text Mining only

HGS (hepatocyte growth factor-regulated tyrosine kinase substrate)

Bookmark This Gene