HES3 (hes family bHLH transcription factor 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 390992
Gene name Hes family bHLH transcription factor 3
Gene symbol HES3
Synonyms (NCBI Gene)
bHLHb43
Chromosome 1
Chromosome location 1p36.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609971 26226 ENSG00000173673
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5TGS1
Protein name Transcription factor HES-3 (Class B basic helix-loop-helix protein 43) (bHLHb43) (Hairy and enhancer of split 3)
Protein function Transcriptional repressor of genes that require a bHLH protein for their transcription.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 1 → 50 Helix-loop-helix DNA-binding domain Domain
Sequence 
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVP
RGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPC
TPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGS
PGDDLN
Sequence length 186
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Human papillomavirus infection

No strongly related genes found yet for HES3.

No additional diseases found yet through genes similar to HES3.