HELT (helt bHLH transcription factor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 391723
• Gene name: Helt bHLH transcription factor
• Gene symbol: HELT
• Synonyms (NCBI Gene): HCM1228, HESL, Mgn, bHLHb44
• Chromosome: 4
• Chromosome location: 4q35.1

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001967	Process	Suckling behavior	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0010467	Process	Gene expression	IEA
GO:0021858	Process	GABAergic neuron differentiation in basal ganglia	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA
GO:0097154	Process	GABAergic neuron differentiation	IEA

Other IDs

• MIM: 617546
• HGNC: 33783
• e!Ensembl: ENSG00000187821

Protein

• UniProt ID: A6NFD8
• Protein name: Hairy and enhancer of split-related protein HELT (HES/HEY-like transcription factor)
• Protein function: Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	12 → 66	Helix-loop-helix DNA-binding domain	Domain
  PF07527	Hairy_orange	86 → 127	Hairy Orange	Domain

• Sequence:

  MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQ
  YLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILA
  FLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPP
  GAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPP
  VL

• Sequence length: 242

Related Genes

No strongly related genes found yet for HELT.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to HELT.