HCFC1R1 (host cell factor C1 regulator 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 54985
Gene name Host cell factor C1 regulator 1
Gene symbol HCFC1R1
Synonyms (NCBI Gene)
HPIP
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1041910 hsa-miR-1178 CLIP-seq
MIRT1041911 hsa-miR-3121-5p CLIP-seq
MIRT1041912 hsa-miR-545 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618818 21198 ENSG00000103145
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NWW0
Protein name Host cell factor C1 regulator 1 (HCF-1 beta-propeller-interacting protein)
Protein function Regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-deriv
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15226 HPIP 2 → 134 HCF-1 beta-propeller-interacting protein family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12235138}.
Sequence 
MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLS
EENMATHFSQLSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLG
DTPSPPYPATPAGDIMEL
Sequence length 138
Interactions View interactions

No strongly related genes found yet for HCFC1R1.

No additional diseases found yet through genes similar to HCFC1R1.