Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3049
Gene name	Hemoglobin subunit theta 1
Gene symbol	HBQ1
Synonyms (NCBI Gene)	HBQ
Chromosome	16
Chromosome location	16p13.3
Summary	Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-glo

miRTarBase ID	miRNA	Experiments	Reference
MIRT030385	hsa-miR-24-3p	Microarray	19748357

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005344	Function	Oxygen carrier activity	IBA
GO:0005344	Function	Oxygen carrier activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 33961781
GO:0005833	Component	Hemoglobin complex	IBA
GO:0005833	Component	Hemoglobin complex	IEA
GO:0005833	Component	Hemoglobin complex	TAS	7555018
GO:0015671	Process	Oxygen transport	IBA
GO:0015671	Process	Oxygen transport	IEA
GO:0015671	Process	Oxygen transport	TAS	7555018
GO:0019825	Function	Oxygen binding	IEA
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0031838	Component	Haptoglobin-hemoglobin complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048821	Process	Erythrocyte development	IBA

MIM	HGNC	e!Ensembl
142240	4833	ENSG00000086506

Protein name

Hemoglobin subunit theta-1 (Hemoglobin theta-1 chain) (Theta-1-globin)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00042	Globin	7 → 107	Globin	Domain

Sequence

MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
QKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSP
ALQASLDKFLSHVISALVSEYR

Sequence length

142

Interactions

View interactions

Related Genes Genes most often co-reported with HBQ1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for HBQ1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to HBQ1 (see Related Genes above), that are NOT already directly curated for HBQ1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to HBQ1.

HBQ1 (hemoglobin subunit theta 1)