HBM (hemoglobin subunit mu)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3042
Gene name Hemoglobin subunit mu
Gene symbol HBM
Synonyms (NCBI Gene)
HBAP2HBK
Chromosome 16
Chromosome location 16p13.3
Summary The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5`- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3`. This gene has an ORF encoding a 141 aa polypeptide which is similar to the
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005344 Function Oxygen carrier activity IBA
GO:0005344 Function Oxygen carrier activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005833 Component Hemoglobin complex IBA
GO:0005833 Component Hemoglobin complex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609639 4826 ENSG00000206177
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6B0K9
Protein name Hemoglobin subunit mu (Hemoglobin mu chain) (Mu-globin)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00042 Globin 6 → 106 Globin Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in erythroid tissues. {ECO:0000269|PubMed:15855277}.
Sequence 
MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQ
RMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQ
MQAAWDKFLTGVAVVLTEKYR
Sequence length 141
Interactions View interactions

No strongly related genes found yet for HBM.

No additional diseases found yet through genes similar to HBM.