Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1839
Gene name	Heparin binding EGF like growth factor
Gene symbol	HBEGF
Synonyms (NCBI Gene)	DTRDTSDTSFHEGFL
Chromosome	5
Chromosome location	5q31.3

124 Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005891	hsa-miR-194-5p	Luciferase reporter assayqRT-PCRWestern blot	20979124
MIRT005891	hsa-miR-194-5p	Luciferase reporter assayqRT-PCRWestern blot	20979124
MIRT006659	hsa-miR-132-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21853268
MIRT006659	hsa-miR-132-3p	Luciferase reporter assay	22310291
MIRT006659	hsa-miR-132-3p	Luciferase reporter assay	22310291
MIRT006659	hsa-miR-132-3p	Microarray	17612493
MIRT024470	hsa-miR-215-5p	Microarray	19074876
MIRT026939	hsa-miR-192-5p	Microarray	19074876
MIRT027820	hsa-miR-98-5p	Microarray	19088304
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT657502	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT657508	hsa-miR-3690	HITS-CLIP	23824327
MIRT657507	hsa-miR-4254	HITS-CLIP	23824327
MIRT657506	hsa-miR-6081	HITS-CLIP	23824327
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT657502	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT657501	hsa-miR-4719	HITS-CLIP	23824327
MIRT657500	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT657499	hsa-miR-1248	HITS-CLIP	23824327
MIRT657498	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT657496	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT657495	hsa-miR-513b-5p	HITS-CLIP	23824327
MIRT657494	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT657493	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT657492	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT657491	hsa-miR-5691	HITS-CLIP	23824327
MIRT657490	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT732695	hsa-miR-96-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	33973871
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT657502	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT657508	hsa-miR-3690	HITS-CLIP	23824327
MIRT657507	hsa-miR-4254	HITS-CLIP	23824327
MIRT657506	hsa-miR-6081	HITS-CLIP	23824327
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT657502	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT657501	hsa-miR-4719	HITS-CLIP	23824327
MIRT657500	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT657499	hsa-miR-1248	HITS-CLIP	23824327
MIRT657498	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT657496	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT657495	hsa-miR-513b-5p	HITS-CLIP	23824327
MIRT657494	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT657493	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT657492	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT657491	hsa-miR-5691	HITS-CLIP	23824327
MIRT657490	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1041441	hsa-miR-132	CLIP-seq
MIRT1041442	hsa-miR-194	CLIP-seq
MIRT1041443	hsa-miR-203	CLIP-seq
MIRT1041444	hsa-miR-2053	CLIP-seq
MIRT1041445	hsa-miR-212	CLIP-seq
MIRT1041446	hsa-miR-2277-3p	CLIP-seq
MIRT1041447	hsa-miR-3180-5p	CLIP-seq
MIRT1041448	hsa-miR-3619-3p	CLIP-seq
MIRT1041449	hsa-miR-3622a-5p	CLIP-seq
MIRT1041450	hsa-miR-3973	CLIP-seq
MIRT1041451	hsa-miR-4423-3p	CLIP-seq
MIRT1041452	hsa-miR-4445	CLIP-seq
MIRT1041453	hsa-miR-4517	CLIP-seq
MIRT1041454	hsa-miR-4640-5p	CLIP-seq
MIRT1041455	hsa-miR-4726-5p	CLIP-seq
MIRT1041456	hsa-miR-4760-5p	CLIP-seq
MIRT1041457	hsa-miR-4795-3p	CLIP-seq
MIRT1041458	hsa-miR-518a-5p	CLIP-seq
MIRT1041459	hsa-miR-520a-5p	CLIP-seq
MIRT1041460	hsa-miR-525-5p	CLIP-seq
MIRT1041461	hsa-miR-527	CLIP-seq
MIRT1041462	hsa-miR-548a-5p	CLIP-seq
MIRT1041463	hsa-miR-548ab	CLIP-seq
MIRT1041464	hsa-miR-548ak	CLIP-seq
MIRT1041465	hsa-miR-548b-5p	CLIP-seq
MIRT1041466	hsa-miR-548c-5p	CLIP-seq
MIRT1041467	hsa-miR-548d-5p	CLIP-seq
MIRT1041468	hsa-miR-548h	CLIP-seq
MIRT1041469	hsa-miR-548i	CLIP-seq
MIRT1041470	hsa-miR-548j	CLIP-seq
MIRT1041471	hsa-miR-548l	CLIP-seq
MIRT1041472	hsa-miR-548w	CLIP-seq
MIRT1041473	hsa-miR-548y	CLIP-seq
MIRT1041474	hsa-miR-559	CLIP-seq
MIRT1041475	hsa-miR-591	CLIP-seq
MIRT1041476	hsa-miR-645	CLIP-seq
MIRT1041477	hsa-miR-656	CLIP-seq
MIRT1041478	hsa-miR-802	CLIP-seq
MIRT2008693	hsa-miR-3065-3p	CLIP-seq
MIRT2008694	hsa-miR-3126-5p	CLIP-seq
MIRT2008695	hsa-miR-3160-5p	CLIP-seq
MIRT2008696	hsa-miR-4419a	CLIP-seq
MIRT2008697	hsa-miR-4510	CLIP-seq
MIRT2008698	hsa-miR-4710	CLIP-seq
MIRT1041441	hsa-miR-132	CLIP-seq
MIRT1041445	hsa-miR-212	CLIP-seq
MIRT2388914	hsa-miR-4773	CLIP-seq
MIRT2450983	hsa-miR-3132	CLIP-seq
MIRT2450984	hsa-miR-4650-3p	CLIP-seq
MIRT2450985	hsa-miR-587	CLIP-seq

9 Show/Hide all (9)

Transcription factor	Regulation	Reference
HIF1A	Activation	22641673
MYOD1	Activation	22641673
NFKB1	Activation	22641673
RELA	Activation	22641673
SNAI1	Activation	22641673
SP1	Activation	22641673
SP3	Activation	22641673
WT1	Activation	22641673
WT1	Unknown	17430890

54 Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	TAS	10749879
GO:0005515	Function	Protein binding	IPI	9135143, 28988771, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8702723
GO:0005615	Component	Extracellular space	IDA	12743035
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005615	Component	Extracellular space	TAS	15389565
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	15389565
GO:0007165	Process	Signal transduction	TAS	1840698
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	8702723
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	17655843
GO:0007517	Process	Muscle organ development	TAS	8347598
GO:0008016	Process	Regulation of heart contraction	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	12070119
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	IMP	8300582
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009986	Component	Cell surface	IDA	12743035
GO:0009986	Component	Cell surface	NAS	15289334
GO:0010561	Process	Negative regulation of glycoprotein biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	8702723
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	17655843
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEA
GO:0038134	Process	ERBB2-EGFR signaling pathway	IEA
GO:0038135	Process	ERBB2-ERBB4 signaling pathway	IEA
GO:0048018	Function	Receptor ligand activity	IDA	8702723
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	17655843
GO:0060326	Process	Cell chemotaxis	IMP	24008408
GO:0090303	Process	Positive regulation of wound healing	IMP	17655843

MIM	HGNC	e!Ensembl
126150	3059	ENSG00000113070

Q99075

Protein name

Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor (HB-EGF) (HBEGF) (Diphtheria toxin receptor) (DT-R)]

Protein function

Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. I

PDB

1XDT , 2M8S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	108 → 142	EGF-like domain	Domain

Sequence

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH

Sequence length

208

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Endocrine resistance	Signaling by ERBB2
ErbB signaling pathway	Signaling by ERBB4
GnRH signaling pathway	SHC1 events in ERBB2 signaling
Estrogen signaling pathway	PI3K events in ERBB4 signaling
Parathyroid hormone synthesis, secretion and action	SHC1 events in ERBB4 signaling
Epithelial cell signaling in Helicobacter pylori infection	PIP3 activates AKT signaling
Coronavirus disease - COVID-19	Signaling by EGFR
Proteoglycans in cancer	GRB2 events in EGFR signaling
Bladder cancer	GAB1 signalosome
	SHC1 events in EGFR signaling
	EGFR downregulation
	GRB2 events in ERBB2 signaling
	PI3K events in ERBB2 signaling
	EGFR interacts with phospholipase C-gamma
	EGFR Transactivation by Gastrin
	Constitutive Signaling by Aberrant PI3K in Cancer
	Uptake and function of diphtheria toxin
	Inhibition of Signaling by Overexpressed EGFR
	RAF/MAP kinase cascade
	ERBB2 Regulates Cell Motility
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
	ERBB2 Activates PTK6 Signaling
	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis
	PTK6 promotes HIF1A stabilization
	Downregulation of ERBB2 signaling
	Extra-nuclear estrogen signaling
	Estrogen-dependent nuclear events downstream of ESR-membrane signaling
	Signaling by ERBB2 KD Mutants
	Signaling by ERBB2 TMD/JMD mutants

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (19)
ALZHEIMER DISEASE	—	GWAS catalog	25778476, 28183528	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	19565504	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	28416822, 36653681, 40050429, 40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	20864642	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TONIC-CLONIC	—	CTD	16023256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	9709397	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	21937979	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	15723263	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONIC-CLONIC EPILEPSY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (159)
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	7635938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26683690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	20131286	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29550070, 30738642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14593587, 30738642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	32415989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23517395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14593587, 30738642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	1577791, 8302833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18463770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	28416822		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	17203208, 24013225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17962208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	29444897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15274392, 23917679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	32386517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34028973, 9244191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22291012, 28668882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25201063	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34320033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15313912, 16000575, 18852147, 19048624, 25060396, 25201063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	21482691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28792970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	15746462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29550070		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28498437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28498437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	28498080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29581578, 30451982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	23597914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17222808, 19221016, 21978696, 29361822, 35633908, 36172359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Factor H Deficiency	Complement component deficiency	Pubtator	22319602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	11922634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptogenic Tonic-Clonic Epilepsy	Cryptogenic Tonic-Clonic Epilepsy	CTD_human_DG	16023256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24658508	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30311190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30311190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	12401248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16962163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Tonic-Clonic, Familial	Epilepsy	CTD_human_DG	16023256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Tonic-Clonic, Symptomatic	Epilepsy	CTD_human_DG	16023256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25201063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22330337, 28864379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	20351696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19298600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	19298600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15509542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15509542, 29559295, 40073406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28368403, 29864158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28368403, 29864158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	9796995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	10547607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35116032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28330901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	20586780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32627036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15723263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	29342116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30738642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	17637826, 19120344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23589494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26800359	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31275059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	LHGDN	16837648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22319602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22319602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	7635938		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	21937979		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	9709397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	10029601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10029601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	22718294		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	23597914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	7958694, 9244191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9244191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28404843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26683690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	LHGDN	15274392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9796995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17203208, 24013225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16962163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22291012, 28668882, 9290266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	22718294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15313912, 16000575, 18852147, 19048624, 25060396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	8060360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14518027, 22110740, 24828490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15723263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21482691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16630129, 17001310, 19421193, 24346967, 29602637, 30451731, 30556643, 31323001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28498437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17962208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24013225, 24828490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26434590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15467833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	26434590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35342363	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	9062361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11468178, 14576062, 17823079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24786973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35886020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28605364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	16567187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	19127210, 20920709, 28953531, 30771819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	19127210, 20920709, 28422949, 28953531, 29601338, 30771819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11507076, 15313912, 16000575, 19048624, 19298600, 23376846, 23443317, 23597914, 24013225, 24828490, 28662101, 29721383, 29997124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	10972674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	10972674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28174207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28174207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28013056		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15313912, 16000575, 18852147, 19048624, 25060396		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18852147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20946474, 25060396, 25261977, 27888810, 34320033, 35342363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	8060360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20208558, 9802880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35342363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27605231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	15988409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	LHGDN	15988409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14518027, 22110740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24828490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27966447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	12835543, 17637826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17637826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	17637826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	12547714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22701684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29581578, 34742261	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30600734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	22319602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	33276795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23597914, 29055839, 30762113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25520391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30451731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20586780, 22209887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20856931, 23146907, 32627036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	20586780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20856931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21482691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	29379775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	29379775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	11920609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15723263		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	19337254, 20946474, 27933395, 29379775, 35264144	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29342116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29044628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23917679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic-Clonic Epilepsy	Tonic-Clonic Epilepsy	CTD_human_DG	16023256		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23443317, 30285805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17394193, 17909029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28498437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	15988409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CTTN	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	2	["Proteoglycans in cancer","Clathrin-mediated endocytosis"]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ACP3	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ACRBP	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ANKRD9	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
AVL9	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]

HBEGF (heparin binding EGF like growth factor)

Bookmark This Gene