H4C7 (H4 clustered histone 7)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 8369 |
| Gene name | H4 clustered histone 7 |
| Gene symbol | H4C7 |
| Synonyms (NCBI Gene) |
H4/lH4FLHIST1H4G
|
| Chromosome | 6 |
| Chromosome location | 6p22.2 |
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
|
|||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q99525 |
| Protein name | Histone H4-like protein type G (H4-clustered histone 7) |
| Protein function | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, |
| Family and domains | |
| Sequence |
MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFK |
| Sequence length | 98 |
| Interactions | View interactions |
|
Pathways
Pathway information has different metabolic/signaling pathways associated with genes.
|
||||||
|
||||||
|
Related Genes
Genes most often co-reported with H4C7 across shared curated disease and pathway associations.
5
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to H4C7 (see Related Genes above), that are NOT already directly curated for H4C7 itself -- a lead worth checking, not a confirmed association.
0
|
|