H3Y2 (H3.Y histone 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 340096
Gene name H3.Y histone 2
Gene symbol H3Y2
Synonyms (NCBI Gene)
H3.XH3.Y.2
Chromosome 5
Chromosome location 5p15.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000786 Component Nucleosome IDA 20819935
GO:0000786 Component Nucleosome IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DPK5
Protein name Histone H3.X (Histone H3.Y2)
Protein function Primate-specific variant histone H3, which constitutes a core component of nucleosomes (PubMed:20819935). Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Hi
PDB 7ZDD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00125 Histone 1 → 132 Core histone H2A/H2B/H3/H4 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at low level in some tissues, such as testis and brain. {ECO:0000269|PubMed:20819935}.
Sequence 
MARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQ
LLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTI
MPRDMQLARRLRGEGAGEPTLLGNLAL
Sequence length 147
Interactions View interactions

No strongly related genes found yet for H3Y2.

No additional diseases found yet through genes similar to H3Y2.