H2BK1 (H2B.K variant histone 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 114483833 |
| Gene name | H2B.K variant histone 1 |
| Gene symbol | H2BK1 |
| Synonyms (NCBI Gene) |
H2BE1
|
| Chromosome | 7 |
| Chromosome location | 7q36.1 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
|
|||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A2R8Y619 | ||||||||||
| Protein name | Histone H2B type 2-K1 (Histone H2B type 2-E1) | ||||||||||
| Protein function | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MSAEYGQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMN |
||||||||||
| Sequence length | 122 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Pathways
Pathway information has different metabolic/signaling pathways associated with genes.
|
||||||
|
||||||
|
Related Genes
Genes most often co-reported with H2BK1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to H2BK1 (see Related Genes above), that are NOT already directly curated for H2BK1 itself -- a lead worth checking, not a confirmed association.
0
|
|