Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	128312
Gene name	H2B clustered histone 26
Gene symbol	H2BC26
Synonyms (NCBI Gene)	H2BU1H2BbHIST3H2BB
Chromosome	1
Chromosome location	1q42.13

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	16319397
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA

MIM	HGNC	e!Ensembl
615046	20514	ENSG00000196890

Q8N257

Protein name

Histone H2B type 3-B (H2B type 12) (H2B-clustered histone 26) (H2B.U histone 1)

Protein function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair,

PDB

6BIZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	2 → 102	Core histone H2A/H2B/H3/H4	Domain

Sequence

MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK

Sequence length

126

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Neutrophil extracellular trap formation	Recognition and association of DNA glycosylase with site containing an affected purine
Alcoholism	Cleavage of the damaged purine
Viral carcinogenesis	Packaging Of Telomere Ends
Systemic lupus erythematosus	Formation of the beta-catenin:TCF transactivating complex
	PRC2 methylates histones and DNA
	Condensation of Prophase Chromosomes
	Oxidative Stress Induced Senescence
	Senescence-Associated Secretory Phenotype (SASP)
	DNA Damage/Telomere Stress Induced Senescence
	HDACs deacetylate histones
	HATs acetylate histones
	SIRT1 negatively regulates rRNA expression
	NoRC negatively regulates rRNA expression
	B-WICH complex positively regulates rRNA expression
	Transcriptional regulation by small RNAs
	Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
	Ub-specific processing proteases
	Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
	Nonhomologous End-Joining (NHEJ)
	Processing of DNA double-strand break ends
	Deposition of new CENPA-containing nucleosomes at the centromere
	G2/M DNA damage checkpoint
	RNA Polymerase I Promoter Opening
	RNA Polymerase I Promoter Escape
	RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
	Estrogen-dependent gene expression
	HCMV Early Events
	HCMV Late Events
	Amyloid fiber formation

Related Genes Genes most often co-reported with H2BC26 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for H2BC26.

Diseases Linked via Similar Genes Diseases curated for genes most similar to H2BC26 (see Related Genes above), that are NOT already directly curated for H2BC26 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to H2BC26.

H2BC26 (H2B clustered histone 26)

Bookmark This Gene