H2BC19P (H2B clustered histone 19, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 337874
Gene name H2B clustered histone 19, pseudogene
Gene symbol H2BC19P
Synonyms (NCBI Gene)
H2B/oH2B/sH2BFOHIST2H2BD
Chromosome 1
Chromosome location 1q21.2
Summary Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000786 Component Nucleosome IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0005694 Component Chromosome IEA
GO:0030527 Function Structural constituent of chromatin IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6DRA6
Protein name Putative histone H2B type 2-D (H2B-clustered histone 19 pseudogene)
Protein function Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00125 Histone 5 → 94 Core histone H2A/H2B/H3/H4 Domain
Sequence 
MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKRVHPDTGIWCKAM
GIMNSFLNDIFERIAGEASRLAHYNKRSTITSRRSRRPCACCCPASWPSTPCPRAPRRSP
STPAPSESLPGPGARSLPPSLPPRVAGCFVSKGSFQGHLTPLVK
Sequence length 164
Interactions View interactions

No strongly related genes found yet for H2BC19P.

No additional diseases found yet through genes similar to H2BC19P.