Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54145
Gene name	H2B clustered histone 12 like
Gene symbol	H2BC12L
Synonyms (NCBI Gene)	H2B/sH2BFSH2BS1
Chromosome	21
Chromosome location	21q22.3

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IEA
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0003677	Function	DNA binding	IEA
GO:0005615	Component	Extracellular space	IDA	12860195
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	16319397
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

P57053

Protein name

Histone H2B type F-S (H2B-clustered histone 12 like) (H2B.S histone 1) (Histone H2B.s) (H2B/s)

Protein function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	2 → 102	Core histone H2A/H2B/H3/H4	Domain

Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK

Sequence length

126

Interactions

View interactions

KEGG Pathway
Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus

Related Genes Genes most often co-reported with H2BC12L across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for H2BC12L.

Diseases Linked via Similar Genes Diseases curated for genes most similar to H2BC12L (see Related Genes above), that are NOT already directly curated for H2BC12L itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to H2BC12L.

H2BC12L (H2B clustered histone 12 like)

Bookmark This Gene