GZMK (granzyme K)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3003
• Gene name: Granzyme K
• Gene symbol: GZMK
• Synonyms (NCBI Gene): TRYP2
• Chromosome: 5
• Chromosome location: 5q11.2
• Summary: This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific tar

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018327	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001905	Process	Activation of membrane attack complex	IDA	18204047
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	17308307, 19059912, 35881628, 39814882, 39914456
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005539	Function	Glycosaminoglycan binding	IDA	39914456
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	39914456
GO:0006508	Process	Proteolysis	IEA
GO:0006956	Process	Complement activation	IDA	26841934, 30111885, 37852260
GO:0008228	Process	Opsonization	IDA	3897448, 8538770
GO:0008228	Process	Opsonization	IDA	39914456
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	8656064
GO:0016787	Function	Hydrolase activity	IEA
GO:0031638	Process	Zymogen activation	IDA	39814882, 39914456
GO:0031640	Process	Killing of cells of another organism	IDA	30552328
GO:0038187	Function	Pattern recognition receptor activity	IDA	39914456
GO:0050729	Process	Positive regulation of inflammatory response	IDA	33271118, 39614076, 39814882, 39914456
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IDA	6906228, 18204047
GO:0051604	Process	Protein maturation	IDA	39814882, 39914456
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	17308307
GO:0106139	Component	Symbiont cell surface	IDA	24711407, 39914456
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IBA
GO:0160257	Process	Complement activation, GZMK pathway	IDA	39814882, 39914456

Other IDs

• MIM: 600784
• HGNC: 4711
• e!Ensembl: ENSG00000113088

Protein

• UniProt ID: P49863
• Protein name: Granzyme K (EC 3.4.21.-) (Fragmentin-3) (Granzyme-3) (NK-tryptase-2) (NK-Tryp-2)
• PDB: 1MZA , 1MZD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	27 → 254	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung, spleen, thymus and peripheral blood leukocytes.
• Sequence:

  MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQ
  WVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLV
  KLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKL
  CNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP
  GIYTLLTKKYQTWIKSNLVPPHTN

• Sequence length: 264

Related Genes

No strongly related genes found yet for GZMK.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GZMK.