GZMA (granzyme A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3001
• Gene name: Granzyme A
• Gene symbol: GZMA
• Synonyms (NCBI Gene): CTLA3, HFSP
• Chromosome: 5
• Chromosome location: 5q11.2
• Summary: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface `nonself` antigens, usually peptid

Gene ontology (GO) Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	TAS	12524539
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	11331782, 12819770, 32299851, 34022140, 36899106
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	12524539
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	11909973
GO:0005737	Component	Cytoplasm	IDA	20038786, 34022140
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	TAS	12524539
GO:0006955	Process	Immune response	TAS	12524539
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0032078	Process	Negative regulation of endodeoxyribonuclease activity	IDA	12524539
GO:0042803	Function	Protein homodimerization activity	IDA	12819770
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12524539
GO:0043392	Process	Negative regulation of DNA binding	IDA	12524539
GO:0051354	Process	Negative regulation of oxidoreductase activity	IDA	12524539
GO:0051603	Process	Proteolysis involved in protein catabolic process	IDA	12524539, 32299851
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IDA	32299851, 34022140
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32299851
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IBA
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	32299851, 34022140
GO:1902483	Process	Cytotoxic T cell pyroptotic cell death	IDA	28154144
GO:1902483	Process	Cytotoxic T cell pyroptotic cell death	IDA	32299851

Other IDs

• MIM: 140050
• HGNC: 4708
• e!Ensembl: ENSG00000145649

Protein

• UniProt ID: P12544
• Protein name: Granzyme A (EC 3.4.21.78) (CTL tryptase) (Cytotoxic T-lymphocyte proteinase 1) (Fragmentin-1) (Granzyme-1) (Hanukkah factor) (H factor) (HF)
• Protein function: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse (PubMed:12819770, PubMed:32299851, PubMed:3257574,
• PDB: 1OP8 , 1ORF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	29 → 254	Trypsin	Domain

• Sequence:

  MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIA
  KDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL
  MEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCN
  DRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGP
  GVYILLSKKHLNWIIMTIKGAV

• Sequence length: 262

Pathways

KEGG Pathway:

Neuroactive ligand-receptor interaction

Related Genes

No strongly related genes found yet for GZMA.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GZMA.