GUSBP1 (GUSB pseudogene 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 728411 |
| Gene name | GUSB pseudogene 1 |
| Gene symbol | GUSBP1 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 5 |
| Chromosome location | 5p14.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q15486 |
| Protein name | Putative inactive beta-glucuronidase-like protein SMA3 |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Ubiquitous. |
| Sequence |
MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGA |
| Sequence length | 140 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with GUSBP1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to GUSBP1 (see Related Genes above), that are NOT already directly curated for GUSBP1 itself -- a lead worth checking, not a confirmed association.
0
|
|