GUCA2A (guanylate cyclase activator 2A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 2980
Gene name Guanylate cyclase activator 2A
Gene symbol GUCA2A
Synonyms (NCBI Gene)
GCAP-IGUCA2STARA
Chromosome 1
Chromosome location 1p34.2
miRNA miRNA information provided by mirtarbase database.
9 Show/Hide all (9)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1038399 hsa-miR-1207-5p CLIP-seq
MIRT1038400 hsa-miR-3616-5p CLIP-seq
MIRT1038401 hsa-miR-3647-5p CLIP-seq
MIRT1038402 hsa-miR-4533 CLIP-seq
MIRT1038403 hsa-miR-4736 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity NAS 7947768
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region NAS 8095028
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
139392 4682 ENSG00000197273
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q02747
Protein name Guanylin (Guanylate cyclase activator 2A) (Guanylate cyclase-activating protein 1) (Guanylate cyclase-activating protein I) (GCAP-I) [Cleaved into: HMW-guanylin; Guanylin]
Protein function Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
PDB 1GNA , 1GNB , 1O8R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02058 Guanylin 21 → 115 Guanylin precursor Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in ileum and colon. Found in plasma.
Sequence 
MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIP
GEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Sequence length 115
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Hormone signaling Digestion
Sort by:
GUCA2B 2 shared pathwaysHormone signaling, Digestion Related via 2 shared pathways including Hormone signaling, Digestion. GUCY2C 2 shared pathwaysHormone signaling, Digestion Related via 2 shared pathways including Hormone signaling, Digestion.
Kidney failure Linked via 1 of 2 related genesGUCA2B Nephrotic syndrome Linked via 1 of 2 related genesGUCA2B Psychiatric disorders Linked via 1 of 2 related genesGUCA2B Systemic lupus erythematosus Linked via 1 of 2 related genesGUCA2B Chronic infantile diarrhea due to guanylate cyclase 2c overactivity Linked via 1 of 2 related genesGUCY2C