GTSCR1 (Gilles de la Tourette syndrome chromosome region, candidate 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 220158 |
| Gene name | Gilles de la Tourette syndrome chromosome region, candidate 1 |
| Gene symbol | GTSCR1 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 18 |
| Chromosome location | 18q22.2 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q86UQ5 |
| Protein name | Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein |
| Family and domains | |
| Sequence |
MQSDIYHPGHSFPSWVLCWVHSCGHEGHLRETAEIRKTHQNGDLQIRGGRGRRESTEIFQ |
| Sequence length | 136 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with GTSCR1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to GTSCR1 (see Related Genes above), that are NOT already directly curated for GTSCR1 itself -- a lead worth checking, not a confirmed association.
0
|
|