Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	2932
Gene name	Glycogen synthase kinase 3 beta
Gene symbol	GSK3B
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3q13.33
Summary	The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction,

1137

Show/Hide all (1137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	20525681
MIRT006753	hsa-miR-29b-3p	Luciferase reporter assay	21501592
MIRT006753	hsa-miR-29b-3p	Luciferase reporter assay	21501592
MIRT021044	hsa-miR-155-5p	Proteomics	19289835
MIRT049345	hsa-miR-92a-3p	CLASH	23622248
MIRT039319	hsa-miR-425-5p	CLASH	23622248
MIRT036842	hsa-miR-877-3p	CLASH	23622248
MIRT004676	hsa-miR-26a-5p	ImmunoblotImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCR	22484120
MIRT004676	hsa-miR-26a-5p	ImmunoblotImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCR	22484120
MIRT053782	hsa-miR-183-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24335145
MIRT053782	hsa-miR-183-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24335145
MIRT053783	hsa-miR-96-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24335145
MIRT053783	hsa-miR-96-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24335145
MIRT053784	hsa-miR-182-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24335145
MIRT053784	hsa-miR-182-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24335145
MIRT437488	hsa-miR-346	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	24023731
MIRT437488	hsa-miR-346	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	24023731
MIRT438593	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT438593	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT438593	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT438593	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT504735	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT504741	hsa-miR-3606-3p	HITS-CLIP	23313552
MIRT504740	hsa-miR-513a-3p	HITS-CLIP	23313552
MIRT504738	hsa-miR-513c-3p	HITS-CLIP	23313552
MIRT504732	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT504739	hsa-miR-369-3p	HITS-CLIP	23313552
MIRT504737	hsa-miR-5692b	HITS-CLIP	23313552
MIRT504736	hsa-miR-5692c	HITS-CLIP	23313552
MIRT120276	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT557465	hsa-miR-1910-5p	HITS-CLIP	23313552
MIRT504734	hsa-miR-374a-5p	HITS-CLIP	23313552
MIRT504733	hsa-miR-374b-5p	HITS-CLIP	23313552
MIRT120269	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT523376	hsa-miR-6083	HITS-CLIP	23313552
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT657557	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT629077	hsa-miR-3065-3p	HITS-CLIP	23824327
MIRT629076	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT657556	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT657555	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT629077	hsa-miR-3065-3p	HITS-CLIP	23824327
MIRT629076	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT557464	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT557463	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT557462	hsa-miR-5683	PAR-CLIP	20371350
MIRT557461	hsa-miR-5697	PAR-CLIP	20371350
MIRT120263	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT120264	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT120265	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT120267	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT120275	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT120266	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT120273	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT120272	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT557460	hsa-miR-1297	PAR-CLIP	20371350
MIRT004676	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT557459	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT557458	hsa-miR-4465	PAR-CLIP	20371350
MIRT504735	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	21572407
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	21572407
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	21572407
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504739	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT504737	hsa-miR-5692b	PAR-CLIP	21572407
MIRT504736	hsa-miR-5692c	PAR-CLIP	21572407
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT557465	hsa-miR-1910-5p	PAR-CLIP	21572407
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT523376	hsa-miR-6083	PAR-CLIP	21572407
MIRT557464	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT557463	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT557462	hsa-miR-5683	PAR-CLIP	21572407
MIRT557461	hsa-miR-5697	PAR-CLIP	21572407
MIRT120275	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT120266	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT120273	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT120272	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT557460	hsa-miR-1297	PAR-CLIP	21572407
MIRT004676	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT557459	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT557458	hsa-miR-4465	PAR-CLIP	21572407
MIRT504735	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523376	hsa-miR-6083	PAR-CLIP	21572407
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	21572407
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	21572407
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	21572407
MIRT504739	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT504737	hsa-miR-5692b	PAR-CLIP	21572407
MIRT504736	hsa-miR-5692c	PAR-CLIP	21572407
MIRT504735	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	22012620
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	22012620
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	22012620
MIRT504739	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT504737	hsa-miR-5692b	PAR-CLIP	22012620
MIRT504736	hsa-miR-5692c	PAR-CLIP	22012620
MIRT504735	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT504735	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504739	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT504737	hsa-miR-5692b	PAR-CLIP	23446348
MIRT504736	hsa-miR-5692c	PAR-CLIP	23446348
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523376	hsa-miR-6083	PAR-CLIP	23446348
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT504739	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT504737	hsa-miR-5692b	PAR-CLIP	23446348
MIRT504736	hsa-miR-5692c	PAR-CLIP	23446348
MIRT504735	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT504739	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT504737	hsa-miR-5692b	PAR-CLIP	23446348
MIRT504736	hsa-miR-5692c	PAR-CLIP	23446348
MIRT504735	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT440532	hsa-miR-409-5p	HITS-CLIP	24374217
MIRT727523	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT727522	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT727520	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT727521	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT440532	hsa-miR-409-5p	HITS-CLIP	24374217
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assay	26854694
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assay	26854694
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assay	26854694
MIRT731560	hsa-miR-9-5p	Luciferase reporter assay	26891291
MIRT731560	hsa-miR-9-5p	Luciferase reporter assay	26891291
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assay	26893786
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assay	26893786
MIRT736850	hsa-miR-99b-3p	Luciferase reporter assayqRT-PCRWestern blot	26315788
MIRT731812	hsa-miR-769-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27470346
MIRT731812	hsa-miR-769-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27470346
MIRT731878	hsa-miR-27a-3p	ChIPLuciferase reporter assayqRT-PCRWestern blot	28122350
MIRT731878	hsa-miR-27a-3p	ChIPLuciferase reporter assayqRT-PCRWestern blot	28122350
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	28237093
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	28237093
MIRT004676	hsa-miR-26a-5p	ImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26469406
MIRT004676	hsa-miR-26a-5p	ImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26469406
MIRT004676	hsa-miR-26a-5p	Luciferase reporter assay	26313916
MIRT732826	hsa-miR-1246	ImmunofluorescenceLuciferase reporter assayqRT-PCR	27639189
MIRT732826	hsa-miR-1246	ImmunofluorescenceLuciferase reporter assayqRT-PCR	27639189
MIRT611911	hsa-miR-4643	HITS-CLIP	27418678
MIRT611910	hsa-miR-8064	HITS-CLIP	27418678
MIRT732980	hsa-miR-132-3p	Luciferase reporter assayqRT-PCRWestern blotting	34162557
MIRT732980	hsa-miR-132-3p	Luciferase reporter assayqRT-PCRWestern blotting	34162557
MIRT732826	hsa-miR-1246	Luciferase reporter assayMass spectrometryqRT-PCRWestern blotting	33172926
MIRT734045	hsa-miR-92b-3p	Luciferase reporter assayMass spectrometryqRT-PCRWestern blotting	33172926
MIRT731878	hsa-miR-27a-3p	Luciferase reporter assayMass spectrometryqRT-PCRWestern blotting	33172926
MIRT734167	hsa-miR-7-2-3p	Immunohistochemistry (IHC)Microarray	31538956
MIRT734300	hsa-miR-675-5p	ELISAImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	32481626
MIRT053784	hsa-miR-182-5p	MicroarrayqRT-PCR	33468167
MIRT731878	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingqRT-PCR	32801869
MIRT736093	hsa-miR-186-5p	qRT-PCR	33133155
MIRT736096	hsa-miR-34c-5p	qRT-PCR	33133155
MIRT004676	hsa-miR-26a-5p	Western blottingImmunofluorescenceqRT-PCR	32290095
MIRT736850	hsa-miR-99b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32814818
MIRT732980	hsa-miR-132-3p	Luciferase reporter assayWestern blottingqRT-PCR	34162557
MIRT504735	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT504741	hsa-miR-3606-3p	HITS-CLIP	23313552
MIRT504740	hsa-miR-513a-3p	HITS-CLIP	23313552
MIRT504738	hsa-miR-513c-3p	HITS-CLIP	23313552
MIRT504732	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT504739	hsa-miR-369-3p	HITS-CLIP	23313552
MIRT504737	hsa-miR-5692b	HITS-CLIP	23313552
MIRT504736	hsa-miR-5692c	HITS-CLIP	23313552
MIRT120276	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT557465	hsa-miR-1910-5p	HITS-CLIP	23313552
MIRT504734	hsa-miR-374a-5p	HITS-CLIP	23313552
MIRT504733	hsa-miR-374b-5p	HITS-CLIP	23313552
MIRT120269	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT523376	hsa-miR-6083	HITS-CLIP	23313552
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT657557	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT629077	hsa-miR-3065-3p	HITS-CLIP	23824327
MIRT629076	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT657556	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT657555	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT629077	hsa-miR-3065-3p	HITS-CLIP	23824327
MIRT629076	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT611912	hsa-miR-8485	HITS-CLIP	23824327
MIRT611911	hsa-miR-4643	HITS-CLIP	23824327
MIRT611910	hsa-miR-8064	HITS-CLIP	23824327
MIRT557464	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT557463	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT557462	hsa-miR-5683	PAR-CLIP	20371350
MIRT557461	hsa-miR-5697	PAR-CLIP	20371350
MIRT120263	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT120264	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT120265	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT120267	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT120275	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT120266	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT120273	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT120272	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT557460	hsa-miR-1297	PAR-CLIP	20371350
MIRT004676	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT557459	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT557458	hsa-miR-4465	PAR-CLIP	20371350
MIRT504735	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	21572407
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	21572407
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	21572407
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504739	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT504737	hsa-miR-5692b	PAR-CLIP	21572407
MIRT504736	hsa-miR-5692c	PAR-CLIP	21572407
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT557465	hsa-miR-1910-5p	PAR-CLIP	21572407
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT523376	hsa-miR-6083	PAR-CLIP	21572407
MIRT557464	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT557463	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT557462	hsa-miR-5683	PAR-CLIP	21572407
MIRT557461	hsa-miR-5697	PAR-CLIP	21572407
MIRT120275	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT120266	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT120273	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT120272	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT557460	hsa-miR-1297	PAR-CLIP	21572407
MIRT004676	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT557459	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT557458	hsa-miR-4465	PAR-CLIP	21572407
MIRT504735	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523376	hsa-miR-6083	PAR-CLIP	21572407
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	21572407
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	21572407
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	21572407
MIRT504739	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT504737	hsa-miR-5692b	PAR-CLIP	21572407
MIRT504736	hsa-miR-5692c	PAR-CLIP	21572407
MIRT504735	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	22012620
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	22012620
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	22012620
MIRT504739	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT504737	hsa-miR-5692b	PAR-CLIP	22012620
MIRT504736	hsa-miR-5692c	PAR-CLIP	22012620
MIRT504735	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT504735	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504739	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT504737	hsa-miR-5692b	PAR-CLIP	23446348
MIRT504736	hsa-miR-5692c	PAR-CLIP	23446348
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523376	hsa-miR-6083	PAR-CLIP	23446348
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT504739	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT504737	hsa-miR-5692b	PAR-CLIP	23446348
MIRT504736	hsa-miR-5692c	PAR-CLIP	23446348
MIRT504735	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT120269	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504741	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT504740	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT504738	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT504739	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT504737	hsa-miR-5692b	PAR-CLIP	23446348
MIRT504736	hsa-miR-5692c	PAR-CLIP	23446348
MIRT504735	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT120276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504734	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504733	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT504732	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT755325	hsa-miR-29b-2-5p	MicroarrayqRT-PCR	35129424
MIRT438593	hsa-miR-199a-5p	Luciferase reporter assayWestern blottingImmunocytochemistry (ICC)	36788811
MIRT1035958	hsa-miR-1178	CLIP-seq
MIRT1035959	hsa-miR-1284	CLIP-seq
MIRT1035960	hsa-miR-1290	CLIP-seq
MIRT1035961	hsa-miR-129-5p	CLIP-seq
MIRT1035962	hsa-miR-132	CLIP-seq
MIRT1035963	hsa-miR-1343	CLIP-seq
MIRT1035964	hsa-miR-2110	CLIP-seq
MIRT1035965	hsa-miR-2113	CLIP-seq
MIRT1035966	hsa-miR-212	CLIP-seq
MIRT1035967	hsa-miR-219-5p	CLIP-seq
MIRT1035968	hsa-miR-224	CLIP-seq
MIRT1035969	hsa-miR-26a	CLIP-seq
MIRT1035970	hsa-miR-26b	CLIP-seq
MIRT1035971	hsa-miR-29a	CLIP-seq
MIRT1035972	hsa-miR-29b	CLIP-seq
MIRT1035973	hsa-miR-29c	CLIP-seq
MIRT1035974	hsa-miR-3121-5p	CLIP-seq
MIRT1035975	hsa-miR-3124-3p	CLIP-seq
MIRT1035976	hsa-miR-3136-3p	CLIP-seq
MIRT1035977	hsa-miR-3143	CLIP-seq
MIRT1035978	hsa-miR-3145-3p	CLIP-seq
MIRT1035979	hsa-miR-3145-5p	CLIP-seq
MIRT1035980	hsa-miR-3148	CLIP-seq
MIRT1035981	hsa-miR-3150a-3p	CLIP-seq
MIRT1035982	hsa-miR-3153	CLIP-seq
MIRT1035983	hsa-miR-3175	CLIP-seq
MIRT1035984	hsa-miR-3183	CLIP-seq
MIRT1035985	hsa-miR-326	CLIP-seq
MIRT1035986	hsa-miR-330-5p	CLIP-seq
MIRT1035987	hsa-miR-338-5p	CLIP-seq
MIRT1035988	hsa-miR-33a	CLIP-seq
MIRT1035989	hsa-miR-33b	CLIP-seq
MIRT1035990	hsa-miR-3617	CLIP-seq
MIRT1035991	hsa-miR-3646	CLIP-seq
MIRT1035992	hsa-miR-3662	CLIP-seq
MIRT1035993	hsa-miR-3691-3p	CLIP-seq
MIRT1035994	hsa-miR-374c	CLIP-seq
MIRT1035995	hsa-miR-376a	CLIP-seq
MIRT1035996	hsa-miR-376b	CLIP-seq
MIRT1035997	hsa-miR-376c	CLIP-seq
MIRT1035998	hsa-miR-4271	CLIP-seq
MIRT1035999	hsa-miR-4330	CLIP-seq
MIRT1036000	hsa-miR-4420	CLIP-seq
MIRT1036001	hsa-miR-4438	CLIP-seq
MIRT1036002	hsa-miR-4445	CLIP-seq
MIRT1036003	hsa-miR-4474-3p	CLIP-seq
MIRT1036004	hsa-miR-4522	CLIP-seq
MIRT1036005	hsa-miR-4667-5p	CLIP-seq
MIRT1036006	hsa-miR-4668-5p	CLIP-seq
MIRT1036007	hsa-miR-4698	CLIP-seq
MIRT1036008	hsa-miR-4699-3p	CLIP-seq
MIRT1036009	hsa-miR-4700-5p	CLIP-seq
MIRT1036010	hsa-miR-4704-5p	CLIP-seq
MIRT1036011	hsa-miR-4714-5p	CLIP-seq
MIRT1036012	hsa-miR-4723-3p	CLIP-seq
MIRT1036013	hsa-miR-4725-3p	CLIP-seq
MIRT1036014	hsa-miR-4731-3p	CLIP-seq
MIRT1036015	hsa-miR-4753-3p	CLIP-seq
MIRT1036016	hsa-miR-4761-5p	CLIP-seq
MIRT1036017	hsa-miR-4768-5p	CLIP-seq
MIRT1036018	hsa-miR-4773	CLIP-seq
MIRT1036019	hsa-miR-4782-3p	CLIP-seq
MIRT1036020	hsa-miR-4801	CLIP-seq
MIRT1036021	hsa-miR-508-3p	CLIP-seq
MIRT1036022	hsa-miR-5095	CLIP-seq
MIRT1036023	hsa-miR-550a	CLIP-seq
MIRT1036024	hsa-miR-624	CLIP-seq
MIRT1036025	hsa-miR-637	CLIP-seq
MIRT1036026	hsa-miR-641	CLIP-seq
MIRT1036027	hsa-miR-655	CLIP-seq
MIRT1036028	hsa-miR-663b	CLIP-seq
MIRT1036029	hsa-miR-889	CLIP-seq
MIRT1036030	hsa-miR-939	CLIP-seq
MIRT1036031	hsa-miR-101	CLIP-seq
MIRT1036032	hsa-miR-106a	CLIP-seq
MIRT1036033	hsa-miR-106b	CLIP-seq
MIRT1035958	hsa-miR-1178	CLIP-seq
MIRT1036034	hsa-miR-1183	CLIP-seq
MIRT1036035	hsa-miR-1225-5p	CLIP-seq
MIRT1036036	hsa-miR-1270	CLIP-seq
MIRT1036037	hsa-miR-1286	CLIP-seq
MIRT1035961	hsa-miR-129-5p	CLIP-seq
MIRT1036038	hsa-miR-1304	CLIP-seq
MIRT1035962	hsa-miR-132	CLIP-seq
MIRT1035963	hsa-miR-1343	CLIP-seq
MIRT1036039	hsa-miR-139-5p	CLIP-seq
MIRT1036040	hsa-miR-142-5p	CLIP-seq
MIRT1036041	hsa-miR-144	CLIP-seq
MIRT1036042	hsa-miR-146b-3p	CLIP-seq
MIRT1036043	hsa-miR-155	CLIP-seq
MIRT1036044	hsa-miR-17	CLIP-seq
MIRT1036045	hsa-miR-1827	CLIP-seq
MIRT1036046	hsa-miR-18a	CLIP-seq
MIRT1036047	hsa-miR-18b	CLIP-seq
MIRT1036048	hsa-miR-192	CLIP-seq
MIRT1036049	hsa-miR-1973	CLIP-seq
MIRT1036050	hsa-miR-20a	CLIP-seq
MIRT1036051	hsa-miR-20b	CLIP-seq
MIRT1035964	hsa-miR-2110	CLIP-seq
MIRT1035966	hsa-miR-212	CLIP-seq
MIRT1036052	hsa-miR-214	CLIP-seq
MIRT1036053	hsa-miR-215	CLIP-seq
MIRT1035969	hsa-miR-26a	CLIP-seq
MIRT1035970	hsa-miR-26b	CLIP-seq
MIRT1036054	hsa-miR-299-3p	CLIP-seq
MIRT1036055	hsa-miR-3149	CLIP-seq
MIRT1036056	hsa-miR-3151	CLIP-seq
MIRT1035982	hsa-miR-3153	CLIP-seq
MIRT1036057	hsa-miR-3173-5p	CLIP-seq
MIRT1036058	hsa-miR-3202	CLIP-seq
MIRT1036059	hsa-miR-340	CLIP-seq
MIRT1036060	hsa-miR-34b	CLIP-seq
MIRT1036061	hsa-miR-3605-3p	CLIP-seq
MIRT1036062	hsa-miR-3609	CLIP-seq
MIRT1036063	hsa-miR-3619-5p	CLIP-seq
MIRT1036064	hsa-miR-3688-5p	CLIP-seq
MIRT1036065	hsa-miR-3910	CLIP-seq
MIRT1036066	hsa-miR-3942-3p	CLIP-seq
MIRT1036067	hsa-miR-3973	CLIP-seq
MIRT1036068	hsa-miR-4266	CLIP-seq
MIRT1035998	hsa-miR-4271	CLIP-seq
MIRT1036069	hsa-miR-4291	CLIP-seq
MIRT1036070	hsa-miR-4314	CLIP-seq
MIRT1036071	hsa-miR-432	CLIP-seq
MIRT1036072	hsa-miR-4424	CLIP-seq
MIRT1036073	hsa-miR-4436a	CLIP-seq
MIRT1036074	hsa-miR-4436b-5p	CLIP-seq
MIRT1036075	hsa-miR-4447	CLIP-seq
MIRT1036076	hsa-miR-4472	CLIP-seq
MIRT1036077	hsa-miR-4484	CLIP-seq
MIRT1036078	hsa-miR-4514	CLIP-seq
MIRT1036079	hsa-miR-4531	CLIP-seq
MIRT1036080	hsa-miR-4533	CLIP-seq
MIRT1036081	hsa-miR-4666-3p	CLIP-seq
MIRT1036082	hsa-miR-4690-5p	CLIP-seq
MIRT1036083	hsa-miR-4692	CLIP-seq
MIRT1036084	hsa-miR-4695-5p	CLIP-seq
MIRT1036085	hsa-miR-4704-3p	CLIP-seq
MIRT1036013	hsa-miR-4725-3p	CLIP-seq
MIRT1036086	hsa-miR-4735-3p	CLIP-seq
MIRT1036087	hsa-miR-4747-5p	CLIP-seq
MIRT1036088	hsa-miR-4779	CLIP-seq
MIRT1036089	hsa-miR-4796-3p	CLIP-seq
MIRT1036090	hsa-miR-4797-5p	CLIP-seq
MIRT1036091	hsa-miR-491-5p	CLIP-seq
MIRT1036092	hsa-miR-511	CLIP-seq
MIRT1036093	hsa-miR-516b	CLIP-seq
MIRT1036094	hsa-miR-519d	CLIP-seq
MIRT1036095	hsa-miR-520g	CLIP-seq
MIRT1036096	hsa-miR-520h	CLIP-seq
MIRT1036097	hsa-miR-543	CLIP-seq
MIRT1036098	hsa-miR-548a-3p	CLIP-seq
MIRT1036099	hsa-miR-548ah	CLIP-seq
MIRT1036100	hsa-miR-548e	CLIP-seq
MIRT1036101	hsa-miR-548f	CLIP-seq
MIRT1036102	hsa-miR-549	CLIP-seq
MIRT1036103	hsa-miR-580	CLIP-seq
MIRT1036104	hsa-miR-582-5p	CLIP-seq
MIRT1036105	hsa-miR-620	CLIP-seq
MIRT1036106	hsa-miR-628-3p	CLIP-seq
MIRT1036107	hsa-miR-634	CLIP-seq
MIRT1036108	hsa-miR-761	CLIP-seq
MIRT1036109	hsa-miR-765	CLIP-seq
MIRT1036110	hsa-miR-874	CLIP-seq
MIRT1036111	hsa-miR-922	CLIP-seq
MIRT1036112	hsa-miR-93	CLIP-seq
MIRT1036113	hsa-miR-935	CLIP-seq
MIRT1036114	hsa-miR-940	CLIP-seq
MIRT1036037	hsa-miR-1286	CLIP-seq
MIRT1556476	hsa-miR-579	CLIP-seq
MIRT1035958	hsa-miR-1178	CLIP-seq
MIRT2007105	hsa-miR-1179	CLIP-seq
MIRT1036034	hsa-miR-1183	CLIP-seq
MIRT2007106	hsa-miR-1184	CLIP-seq
MIRT2007107	hsa-miR-1205	CLIP-seq
MIRT2007108	hsa-miR-1231	CLIP-seq
MIRT1035959	hsa-miR-1284	CLIP-seq
MIRT2007109	hsa-miR-1285	CLIP-seq
MIRT1036037	hsa-miR-1286	CLIP-seq
MIRT1035961	hsa-miR-129-5p	CLIP-seq
MIRT1035962	hsa-miR-132	CLIP-seq
MIRT1035963	hsa-miR-1343	CLIP-seq
MIRT1036039	hsa-miR-139-5p	CLIP-seq
MIRT1036040	hsa-miR-142-5p	CLIP-seq
MIRT1036042	hsa-miR-146b-3p	CLIP-seq
MIRT2007110	hsa-miR-1915	CLIP-seq
MIRT1036048	hsa-miR-192	CLIP-seq
MIRT1035966	hsa-miR-212	CLIP-seq
MIRT1036052	hsa-miR-214	CLIP-seq
MIRT1036053	hsa-miR-215	CLIP-seq
MIRT2007111	hsa-miR-24	CLIP-seq
MIRT2007112	hsa-miR-25	CLIP-seq
MIRT1035969	hsa-miR-26a	CLIP-seq
MIRT1035970	hsa-miR-26b	CLIP-seq
MIRT2007113	hsa-miR-300	CLIP-seq
MIRT2007114	hsa-miR-302f	CLIP-seq
MIRT2007115	hsa-miR-3117-5p	CLIP-seq
MIRT2007116	hsa-miR-3120-5p	CLIP-seq
MIRT2007117	hsa-miR-3122	CLIP-seq
MIRT1035975	hsa-miR-3124-3p	CLIP-seq
MIRT2007118	hsa-miR-3127-3p	CLIP-seq
MIRT2007119	hsa-miR-3140-3p	CLIP-seq
MIRT2007120	hsa-miR-3144-3p	CLIP-seq
MIRT1035978	hsa-miR-3145-3p	CLIP-seq
MIRT1035979	hsa-miR-3145-5p	CLIP-seq
MIRT1035980	hsa-miR-3148	CLIP-seq
MIRT2007121	hsa-miR-3158-5p	CLIP-seq
MIRT2007122	hsa-miR-3163	CLIP-seq
MIRT2007123	hsa-miR-3173-3p	CLIP-seq
MIRT1036057	hsa-miR-3173-5p	CLIP-seq
MIRT2007124	hsa-miR-3179	CLIP-seq
MIRT2007125	hsa-miR-3187-5p	CLIP-seq
MIRT2007126	hsa-miR-3190	CLIP-seq
MIRT2007127	hsa-miR-3194-3p	CLIP-seq
MIRT2007128	hsa-miR-32	CLIP-seq
MIRT1036058	hsa-miR-3202	CLIP-seq
MIRT2007129	hsa-miR-324-5p	CLIP-seq
MIRT2007130	hsa-miR-330-3p	CLIP-seq
MIRT1036060	hsa-miR-34b	CLIP-seq
MIRT1036062	hsa-miR-3609	CLIP-seq
MIRT2007131	hsa-miR-3613-3p	CLIP-seq
MIRT2007132	hsa-miR-3614-5p	CLIP-seq
MIRT1036063	hsa-miR-3619-5p	CLIP-seq
MIRT2007133	hsa-miR-363	CLIP-seq
MIRT1035991	hsa-miR-3646	CLIP-seq
MIRT2007134	hsa-miR-3647-3p	CLIP-seq
MIRT2007135	hsa-miR-3658	CLIP-seq
MIRT2007136	hsa-miR-3661	CLIP-seq
MIRT2007137	hsa-miR-3665	CLIP-seq
MIRT2007138	hsa-miR-367	CLIP-seq
MIRT2007139	hsa-miR-3671	CLIP-seq
MIRT2007140	hsa-miR-3684	CLIP-seq
MIRT2007141	hsa-miR-3689a-3p	CLIP-seq
MIRT2007142	hsa-miR-3689c	CLIP-seq
MIRT2007143	hsa-miR-371-5p	CLIP-seq
MIRT2007144	hsa-miR-371b-5p	CLIP-seq
MIRT1035994	hsa-miR-374c	CLIP-seq
MIRT2007145	hsa-miR-381	CLIP-seq
MIRT2007146	hsa-miR-3909	CLIP-seq
MIRT2007147	hsa-miR-3913-5p	CLIP-seq
MIRT2007148	hsa-miR-3935	CLIP-seq
MIRT1036066	hsa-miR-3942-3p	CLIP-seq
MIRT2007149	hsa-miR-4279	CLIP-seq
MIRT2007150	hsa-miR-4288	CLIP-seq
MIRT1036069	hsa-miR-4291	CLIP-seq
MIRT2007151	hsa-miR-4292	CLIP-seq
MIRT2007152	hsa-miR-4308	CLIP-seq
MIRT2007153	hsa-miR-4325	CLIP-seq
MIRT2007154	hsa-miR-4427	CLIP-seq
MIRT2007155	hsa-miR-4428	CLIP-seq
MIRT2007156	hsa-miR-4437	CLIP-seq
MIRT1036001	hsa-miR-4438	CLIP-seq
MIRT2007157	hsa-miR-4477a	CLIP-seq
MIRT2007158	hsa-miR-4477b	CLIP-seq
MIRT2007159	hsa-miR-4494	CLIP-seq
MIRT2007160	hsa-miR-4502	CLIP-seq
MIRT2007161	hsa-miR-4511	CLIP-seq
MIRT1036078	hsa-miR-4514	CLIP-seq
MIRT2007162	hsa-miR-4639-3p	CLIP-seq
MIRT2007163	hsa-miR-4639-5p	CLIP-seq
MIRT2007164	hsa-miR-4653-3p	CLIP-seq
MIRT2007165	hsa-miR-4659a-3p	CLIP-seq
MIRT2007166	hsa-miR-4659b-3p	CLIP-seq
MIRT1036081	hsa-miR-4666-3p	CLIP-seq
MIRT1036006	hsa-miR-4668-5p	CLIP-seq
MIRT2007167	hsa-miR-4671-5p	CLIP-seq
MIRT2007168	hsa-miR-4674	CLIP-seq
MIRT2007169	hsa-miR-4680-3p	CLIP-seq
MIRT2007170	hsa-miR-4684-5p	CLIP-seq
MIRT2007171	hsa-miR-4686	CLIP-seq
MIRT1036083	hsa-miR-4692	CLIP-seq
MIRT2007172	hsa-miR-4695-3p	CLIP-seq
MIRT2007173	hsa-miR-4703-3p	CLIP-seq
MIRT1036085	hsa-miR-4704-3p	CLIP-seq
MIRT1036010	hsa-miR-4704-5p	CLIP-seq
MIRT2007174	hsa-miR-4715-3p	CLIP-seq
MIRT2007175	hsa-miR-4720-5p	CLIP-seq
MIRT2007176	hsa-miR-4726-3p	CLIP-seq
MIRT2007177	hsa-miR-4728-3p	CLIP-seq
MIRT2007178	hsa-miR-4728-5p	CLIP-seq
MIRT1036014	hsa-miR-4731-3p	CLIP-seq
MIRT2007179	hsa-miR-4731-5p	CLIP-seq
MIRT2007180	hsa-miR-4738-3p	CLIP-seq
MIRT2007181	hsa-miR-4762-3p	CLIP-seq
MIRT2007182	hsa-miR-4762-5p	CLIP-seq
MIRT2007183	hsa-miR-4766-5p	CLIP-seq
MIRT1036017	hsa-miR-4768-5p	CLIP-seq
MIRT2007184	hsa-miR-4778-5p	CLIP-seq
MIRT2007185	hsa-miR-4795-3p	CLIP-seq
MIRT2007186	hsa-miR-4796-5p	CLIP-seq
MIRT2007187	hsa-miR-4799-3p	CLIP-seq
MIRT1036020	hsa-miR-4801	CLIP-seq
MIRT2007188	hsa-miR-4803	CLIP-seq
MIRT2007189	hsa-miR-499a-5p	CLIP-seq
MIRT1036022	hsa-miR-5095	CLIP-seq
MIRT2007190	hsa-miR-522	CLIP-seq
MIRT1036099	hsa-miR-548ah	CLIP-seq
MIRT2007191	hsa-miR-548an	CLIP-seq
MIRT2007192	hsa-miR-548m	CLIP-seq
MIRT2007193	hsa-miR-568	CLIP-seq
MIRT2007194	hsa-miR-577	CLIP-seq
MIRT1556476	hsa-miR-579	CLIP-seq
MIRT1036103	hsa-miR-580	CLIP-seq
MIRT2007195	hsa-miR-582-3p	CLIP-seq
MIRT1036104	hsa-miR-582-5p	CLIP-seq
MIRT2007196	hsa-miR-583	CLIP-seq
MIRT2007197	hsa-miR-596	CLIP-seq
MIRT2007198	hsa-miR-601	CLIP-seq
MIRT2007199	hsa-miR-607	CLIP-seq
MIRT2007200	hsa-miR-612	CLIP-seq
MIRT2007201	hsa-miR-619	CLIP-seq
MIRT2007202	hsa-miR-631	CLIP-seq
MIRT2007203	hsa-miR-632	CLIP-seq
MIRT2007204	hsa-miR-643	CLIP-seq
MIRT2007205	hsa-miR-646	CLIP-seq
MIRT1036027	hsa-miR-655	CLIP-seq
MIRT2007206	hsa-miR-657	CLIP-seq
MIRT2007207	hsa-miR-668	CLIP-seq
MIRT1036108	hsa-miR-761	CLIP-seq
MIRT2007208	hsa-miR-767-3p	CLIP-seq
MIRT1036110	hsa-miR-874	CLIP-seq
MIRT2007209	hsa-miR-875-5p	CLIP-seq
MIRT2007210	hsa-miR-9	CLIP-seq
MIRT1036111	hsa-miR-922	CLIP-seq
MIRT2007211	hsa-miR-92a	CLIP-seq
MIRT2007212	hsa-miR-92b	CLIP-seq
MIRT1036113	hsa-miR-935	CLIP-seq
MIRT1036114	hsa-miR-940	CLIP-seq
MIRT1036058	hsa-miR-3202	CLIP-seq
MIRT2239632	hsa-miR-659	CLIP-seq
MIRT1036031	hsa-miR-101	CLIP-seq
MIRT1036032	hsa-miR-106a	CLIP-seq
MIRT1036033	hsa-miR-106b	CLIP-seq
MIRT1035958	hsa-miR-1178	CLIP-seq
MIRT2007105	hsa-miR-1179	CLIP-seq
MIRT1036034	hsa-miR-1183	CLIP-seq
MIRT2007106	hsa-miR-1184	CLIP-seq
MIRT2239633	hsa-miR-1200	CLIP-seq
MIRT2007107	hsa-miR-1205	CLIP-seq
MIRT2239634	hsa-miR-1207-3p	CLIP-seq
MIRT2239635	hsa-miR-1207-5p	CLIP-seq
MIRT2239636	hsa-miR-1236	CLIP-seq
MIRT2239637	hsa-miR-1238	CLIP-seq
MIRT2239638	hsa-miR-124	CLIP-seq
MIRT2239639	hsa-miR-1245	CLIP-seq
MIRT2239640	hsa-miR-125a-5p	CLIP-seq
MIRT2239641	hsa-miR-125b	CLIP-seq
MIRT2239642	hsa-miR-1260	CLIP-seq
MIRT2239643	hsa-miR-1260b	CLIP-seq
MIRT1036036	hsa-miR-1270	CLIP-seq
MIRT2239644	hsa-miR-1273f	CLIP-seq
MIRT2239645	hsa-miR-128	CLIP-seq
MIRT1035959	hsa-miR-1284	CLIP-seq
MIRT2007109	hsa-miR-1285	CLIP-seq
MIRT1036037	hsa-miR-1286	CLIP-seq
MIRT1035961	hsa-miR-129-5p	CLIP-seq
MIRT2239646	hsa-miR-1296	CLIP-seq
MIRT2239647	hsa-miR-1301	CLIP-seq
MIRT2239648	hsa-miR-1303	CLIP-seq
MIRT1035962	hsa-miR-132	CLIP-seq
MIRT2239649	hsa-miR-134	CLIP-seq
MIRT1035963	hsa-miR-1343	CLIP-seq
MIRT2239650	hsa-miR-137	CLIP-seq
MIRT1036039	hsa-miR-139-5p	CLIP-seq
MIRT1036040	hsa-miR-142-5p	CLIP-seq
MIRT2239651	hsa-miR-143	CLIP-seq
MIRT1036041	hsa-miR-144	CLIP-seq
MIRT1036042	hsa-miR-146b-3p	CLIP-seq
MIRT2239652	hsa-miR-151-5p	CLIP-seq
MIRT2239653	hsa-miR-151b	CLIP-seq
MIRT1036043	hsa-miR-155	CLIP-seq
MIRT1036044	hsa-miR-17	CLIP-seq
MIRT2239654	hsa-miR-181a	CLIP-seq
MIRT2239655	hsa-miR-181b	CLIP-seq
MIRT2239656	hsa-miR-181c	CLIP-seq
MIRT2239657	hsa-miR-181d	CLIP-seq
MIRT2239658	hsa-miR-185	CLIP-seq
MIRT2239659	hsa-miR-188-3p	CLIP-seq
MIRT2239660	hsa-miR-188-5p	CLIP-seq
MIRT1036046	hsa-miR-18a	CLIP-seq
MIRT1036047	hsa-miR-18b	CLIP-seq
MIRT2239661	hsa-miR-1910	CLIP-seq
MIRT2239662	hsa-miR-1914	CLIP-seq
MIRT1036048	hsa-miR-192	CLIP-seq
MIRT2239663	hsa-miR-198	CLIP-seq
MIRT2239664	hsa-miR-205	CLIP-seq
MIRT1036050	hsa-miR-20a	CLIP-seq
MIRT1036051	hsa-miR-20b	CLIP-seq
MIRT1035964	hsa-miR-2110	CLIP-seq
MIRT1035966	hsa-miR-212	CLIP-seq
MIRT1036052	hsa-miR-214	CLIP-seq
MIRT1036053	hsa-miR-215	CLIP-seq
MIRT1035967	hsa-miR-219-5p	CLIP-seq
MIRT1035968	hsa-miR-224	CLIP-seq
MIRT2239665	hsa-miR-2278	CLIP-seq
MIRT2239666	hsa-miR-23a	CLIP-seq
MIRT2239667	hsa-miR-23b	CLIP-seq
MIRT2239668	hsa-miR-23c	CLIP-seq
MIRT2007111	hsa-miR-24	CLIP-seq
MIRT2007112	hsa-miR-25	CLIP-seq
MIRT1035969	hsa-miR-26a	CLIP-seq
MIRT1035970	hsa-miR-26b	CLIP-seq
MIRT2239669	hsa-miR-27a	CLIP-seq
MIRT2239670	hsa-miR-27b	CLIP-seq
MIRT2239671	hsa-miR-2861	CLIP-seq
MIRT2239672	hsa-miR-297	CLIP-seq
MIRT1036054	hsa-miR-299-3p	CLIP-seq
MIRT1035971	hsa-miR-29a	CLIP-seq
MIRT1035972	hsa-miR-29b	CLIP-seq
MIRT1035973	hsa-miR-29c	CLIP-seq
MIRT2007113	hsa-miR-300	CLIP-seq
MIRT2007114	hsa-miR-302f	CLIP-seq
MIRT2239673	hsa-miR-3074-3p	CLIP-seq
MIRT2239674	hsa-miR-3074-5p	CLIP-seq
MIRT2239675	hsa-miR-3118	CLIP-seq
MIRT2007117	hsa-miR-3122	CLIP-seq
MIRT1035975	hsa-miR-3124-3p	CLIP-seq
MIRT2007118	hsa-miR-3127-3p	CLIP-seq
MIRT1035976	hsa-miR-3136-3p	CLIP-seq
MIRT2007119	hsa-miR-3140-3p	CLIP-seq
MIRT1035979	hsa-miR-3145-5p	CLIP-seq
MIRT1036055	hsa-miR-3149	CLIP-seq
MIRT2239676	hsa-miR-3150b-3p	CLIP-seq
MIRT1036056	hsa-miR-3151	CLIP-seq
MIRT1035982	hsa-miR-3153	CLIP-seq
MIRT2239677	hsa-miR-3156-3p	CLIP-seq
MIRT2239678	hsa-miR-3158-3p	CLIP-seq
MIRT2007121	hsa-miR-3158-5p	CLIP-seq
MIRT2239679	hsa-miR-3171	CLIP-seq
MIRT2007123	hsa-miR-3173-3p	CLIP-seq
MIRT1036057	hsa-miR-3173-5p	CLIP-seq
MIRT2007124	hsa-miR-3179	CLIP-seq
MIRT1035984	hsa-miR-3183	CLIP-seq
MIRT2007125	hsa-miR-3187-5p	CLIP-seq
MIRT2007126	hsa-miR-3190	CLIP-seq
MIRT2007127	hsa-miR-3194-3p	CLIP-seq
MIRT2007128	hsa-miR-32	CLIP-seq
MIRT1036058	hsa-miR-3202	CLIP-seq
MIRT2239680	hsa-miR-323-5p	CLIP-seq
MIRT2239681	hsa-miR-323b-5p	CLIP-seq
MIRT2007129	hsa-miR-324-5p	CLIP-seq
MIRT1035985	hsa-miR-326	CLIP-seq
MIRT2239682	hsa-miR-329	CLIP-seq
MIRT1035986	hsa-miR-330-5p	CLIP-seq
MIRT2239683	hsa-miR-337-3p	CLIP-seq
MIRT1035987	hsa-miR-338-5p	CLIP-seq
MIRT2239684	hsa-miR-339-5p	CLIP-seq
MIRT1036059	hsa-miR-340	CLIP-seq
MIRT1036060	hsa-miR-34b	CLIP-seq
MIRT2239685	hsa-miR-34c-3p	CLIP-seq
MIRT1036062	hsa-miR-3609	CLIP-seq
MIRT2007131	hsa-miR-3613-3p	CLIP-seq
MIRT2239686	hsa-miR-3616-3p	CLIP-seq
MIRT1035990	hsa-miR-3617	CLIP-seq
MIRT1036063	hsa-miR-3619-5p	CLIP-seq
MIRT2239687	hsa-miR-362-3p	CLIP-seq
MIRT2007133	hsa-miR-363	CLIP-seq
MIRT1035991	hsa-miR-3646	CLIP-seq
MIRT2007134	hsa-miR-3647-3p	CLIP-seq
MIRT2007135	hsa-miR-3658	CLIP-seq
MIRT2007136	hsa-miR-3661	CLIP-seq
MIRT2007137	hsa-miR-3665	CLIP-seq
MIRT2239688	hsa-miR-3667-3p	CLIP-seq
MIRT2007138	hsa-miR-367	CLIP-seq
MIRT2239689	hsa-miR-3677-3p	CLIP-seq
MIRT2007140	hsa-miR-3684	CLIP-seq
MIRT2239690	hsa-miR-3685	CLIP-seq
MIRT1036064	hsa-miR-3688-5p	CLIP-seq
MIRT2007141	hsa-miR-3689a-3p	CLIP-seq
MIRT2007142	hsa-miR-3689c	CLIP-seq
MIRT1035993	hsa-miR-3691-3p	CLIP-seq
MIRT2239691	hsa-miR-3713	CLIP-seq
MIRT2239692	hsa-miR-3714	CLIP-seq
MIRT1035994	hsa-miR-374c	CLIP-seq
MIRT1035995	hsa-miR-376a	CLIP-seq
MIRT1035996	hsa-miR-376b	CLIP-seq
MIRT1035997	hsa-miR-376c	CLIP-seq
MIRT2239693	hsa-miR-377	CLIP-seq
MIRT2239694	hsa-miR-378g	CLIP-seq
MIRT2007145	hsa-miR-381	CLIP-seq
MIRT2239695	hsa-miR-384	CLIP-seq
MIRT2007146	hsa-miR-3909	CLIP-seq
MIRT1036065	hsa-miR-3910	CLIP-seq
MIRT2007147	hsa-miR-3913-5p	CLIP-seq
MIRT2007148	hsa-miR-3935	CLIP-seq
MIRT2239696	hsa-miR-3941	CLIP-seq
MIRT1036066	hsa-miR-3942-3p	CLIP-seq
MIRT2239697	hsa-miR-3944-5p	CLIP-seq
MIRT2239698	hsa-miR-4262	CLIP-seq
MIRT1036068	hsa-miR-4266	CLIP-seq
MIRT1035998	hsa-miR-4271	CLIP-seq
MIRT2239699	hsa-miR-4276	CLIP-seq
MIRT2239700	hsa-miR-4284	CLIP-seq
MIRT2007150	hsa-miR-4288	CLIP-seq
MIRT1036069	hsa-miR-4291	CLIP-seq
MIRT2239701	hsa-miR-4301	CLIP-seq
MIRT2239702	hsa-miR-4306	CLIP-seq
MIRT2239703	hsa-miR-4318	CLIP-seq
MIRT2239704	hsa-miR-4319	CLIP-seq
MIRT1036071	hsa-miR-432	CLIP-seq
MIRT2239705	hsa-miR-4324	CLIP-seq
MIRT2007153	hsa-miR-4325	CLIP-seq
MIRT1036000	hsa-miR-4420	CLIP-seq
MIRT1036072	hsa-miR-4424	CLIP-seq
MIRT2239706	hsa-miR-4426	CLIP-seq
MIRT2007154	hsa-miR-4427	CLIP-seq
MIRT2007155	hsa-miR-4428	CLIP-seq
MIRT1036073	hsa-miR-4436a	CLIP-seq
MIRT2007156	hsa-miR-4437	CLIP-seq
MIRT1036001	hsa-miR-4438	CLIP-seq
MIRT2239707	hsa-miR-4440	CLIP-seq
MIRT1036075	hsa-miR-4447	CLIP-seq
MIRT2239708	hsa-miR-4456	CLIP-seq
MIRT2239709	hsa-miR-4457	CLIP-seq
MIRT2239710	hsa-miR-4470	CLIP-seq
MIRT1036076	hsa-miR-4472	CLIP-seq
MIRT2007157	hsa-miR-4477a	CLIP-seq
MIRT2007158	hsa-miR-4477b	CLIP-seq
MIRT1036077	hsa-miR-4484	CLIP-seq
MIRT2239711	hsa-miR-4486	CLIP-seq
MIRT2007159	hsa-miR-4494	CLIP-seq
MIRT2239712	hsa-miR-4495	CLIP-seq
MIRT2007160	hsa-miR-4502	CLIP-seq
MIRT2239713	hsa-miR-4512	CLIP-seq
MIRT1036078	hsa-miR-4514	CLIP-seq
MIRT2239714	hsa-miR-4519	CLIP-seq
MIRT2239715	hsa-miR-4523	CLIP-seq
MIRT2239716	hsa-miR-4529-5p	CLIP-seq
MIRT1036079	hsa-miR-4531	CLIP-seq
MIRT1036080	hsa-miR-4533	CLIP-seq
MIRT2239717	hsa-miR-4540	CLIP-seq
MIRT2007162	hsa-miR-4639-3p	CLIP-seq
MIRT2007163	hsa-miR-4639-5p	CLIP-seq
MIRT2239718	hsa-miR-4644	CLIP-seq
MIRT2239719	hsa-miR-4647	CLIP-seq
MIRT2007164	hsa-miR-4653-3p	CLIP-seq
MIRT2007165	hsa-miR-4659a-3p	CLIP-seq
MIRT2007166	hsa-miR-4659b-3p	CLIP-seq
MIRT2239720	hsa-miR-466	CLIP-seq
MIRT2239721	hsa-miR-4660	CLIP-seq
MIRT2239722	hsa-miR-4662b	CLIP-seq
MIRT1036081	hsa-miR-4666-3p	CLIP-seq
MIRT1036005	hsa-miR-4667-5p	CLIP-seq
MIRT2007167	hsa-miR-4671-5p	CLIP-seq
MIRT2239723	hsa-miR-4672	CLIP-seq
MIRT2007168	hsa-miR-4674	CLIP-seq
MIRT2007169	hsa-miR-4680-3p	CLIP-seq
MIRT2239724	hsa-miR-4688	CLIP-seq
MIRT2239725	hsa-miR-4689	CLIP-seq
MIRT1036082	hsa-miR-4690-5p	CLIP-seq
MIRT1036083	hsa-miR-4692	CLIP-seq
MIRT2007172	hsa-miR-4695-3p	CLIP-seq
MIRT1036084	hsa-miR-4695-5p	CLIP-seq
MIRT1036007	hsa-miR-4698	CLIP-seq
MIRT1036008	hsa-miR-4699-3p	CLIP-seq
MIRT1036009	hsa-miR-4700-5p	CLIP-seq
MIRT1036085	hsa-miR-4704-3p	CLIP-seq
MIRT1036010	hsa-miR-4704-5p	CLIP-seq
MIRT2239726	hsa-miR-4708-5p	CLIP-seq
MIRT2239727	hsa-miR-4710	CLIP-seq
MIRT2007174	hsa-miR-4715-3p	CLIP-seq
MIRT2239728	hsa-miR-4717-3p	CLIP-seq
MIRT2239729	hsa-miR-4721	CLIP-seq
MIRT1036012	hsa-miR-4723-3p	CLIP-seq
MIRT1036013	hsa-miR-4725-3p	CLIP-seq
MIRT2239730	hsa-miR-4727-5p	CLIP-seq
MIRT2007177	hsa-miR-4728-3p	CLIP-seq
MIRT2007178	hsa-miR-4728-5p	CLIP-seq
MIRT2239731	hsa-miR-4729	CLIP-seq
MIRT1036014	hsa-miR-4731-3p	CLIP-seq
MIRT2007179	hsa-miR-4731-5p	CLIP-seq
MIRT2239732	hsa-miR-4732-3p	CLIP-seq
MIRT2239733	hsa-miR-4732-5p	CLIP-seq
MIRT1036086	hsa-miR-4735-3p	CLIP-seq
MIRT2007180	hsa-miR-4738-3p	CLIP-seq
MIRT1036087	hsa-miR-4747-5p	CLIP-seq
MIRT1036015	hsa-miR-4753-3p	CLIP-seq
MIRT1036016	hsa-miR-4761-5p	CLIP-seq
MIRT2007181	hsa-miR-4762-3p	CLIP-seq
MIRT2239734	hsa-miR-4763-3p	CLIP-seq
MIRT2239735	hsa-miR-4770	CLIP-seq
MIRT1036018	hsa-miR-4773	CLIP-seq
MIRT1036088	hsa-miR-4779	CLIP-seq
MIRT1036019	hsa-miR-4782-3p	CLIP-seq
MIRT2239736	hsa-miR-4784	CLIP-seq
MIRT2239737	hsa-miR-4792	CLIP-seq
MIRT2007185	hsa-miR-4795-3p	CLIP-seq
MIRT1036089	hsa-miR-4796-3p	CLIP-seq
MIRT2007186	hsa-miR-4796-5p	CLIP-seq
MIRT1036090	hsa-miR-4797-5p	CLIP-seq
MIRT1036020	hsa-miR-4801	CLIP-seq
MIRT2239738	hsa-miR-4802-3p	CLIP-seq
MIRT2239739	hsa-miR-483-3p	CLIP-seq
MIRT1036091	hsa-miR-491-5p	CLIP-seq
MIRT2239740	hsa-miR-494	CLIP-seq
MIRT2239741	hsa-miR-495	CLIP-seq
MIRT2239742	hsa-miR-496	CLIP-seq
MIRT2007189	hsa-miR-499a-5p	CLIP-seq
MIRT2239743	hsa-miR-5047	CLIP-seq
MIRT2239744	hsa-miR-506	CLIP-seq
MIRT1036021	hsa-miR-508-3p	CLIP-seq
MIRT1036022	hsa-miR-5095	CLIP-seq
MIRT2239745	hsa-miR-513a-5p	CLIP-seq
MIRT2239746	hsa-miR-513c	CLIP-seq
MIRT2239747	hsa-miR-514b-5p	CLIP-seq
MIRT1036093	hsa-miR-516b	CLIP-seq
MIRT1036094	hsa-miR-519d	CLIP-seq
MIRT2239748	hsa-miR-520a-5p	CLIP-seq
MIRT2239749	hsa-miR-525-5p	CLIP-seq
MIRT1036097	hsa-miR-543	CLIP-seq
MIRT2239750	hsa-miR-544b	CLIP-seq
MIRT1036098	hsa-miR-548a-3p	CLIP-seq
MIRT2239751	hsa-miR-548a-5p	CLIP-seq
MIRT2239752	hsa-miR-548ab	CLIP-seq
MIRT1036099	hsa-miR-548ah	CLIP-seq
MIRT2239753	hsa-miR-548ak	CLIP-seq
MIRT2239754	hsa-miR-548al	CLIP-seq
MIRT2007191	hsa-miR-548an	CLIP-seq
MIRT2239755	hsa-miR-548b-5p	CLIP-seq
MIRT2239756	hsa-miR-548c-5p	CLIP-seq
MIRT2239757	hsa-miR-548d-5p	CLIP-seq
MIRT1036100	hsa-miR-548e	CLIP-seq
MIRT1036101	hsa-miR-548f	CLIP-seq
MIRT2239758	hsa-miR-548g	CLIP-seq
MIRT2239759	hsa-miR-548h	CLIP-seq
MIRT2239760	hsa-miR-548i	CLIP-seq
MIRT2239761	hsa-miR-548j	CLIP-seq
MIRT2239762	hsa-miR-548k	CLIP-seq
MIRT2239763	hsa-miR-548l	CLIP-seq
MIRT2239764	hsa-miR-548w	CLIP-seq
MIRT2239765	hsa-miR-548y	CLIP-seq
MIRT1036102	hsa-miR-549	CLIP-seq
MIRT2239766	hsa-miR-559	CLIP-seq
MIRT2239767	hsa-miR-561	CLIP-seq
MIRT2239768	hsa-miR-567	CLIP-seq
MIRT2007194	hsa-miR-577	CLIP-seq
MIRT1556476	hsa-miR-579	CLIP-seq
MIRT2007195	hsa-miR-582-3p	CLIP-seq
MIRT1036104	hsa-miR-582-5p	CLIP-seq
MIRT2239769	hsa-miR-593	CLIP-seq
MIRT2007197	hsa-miR-596	CLIP-seq
MIRT2239770	hsa-miR-603	CLIP-seq
MIRT2239771	hsa-miR-606	CLIP-seq
MIRT2007200	hsa-miR-612	CLIP-seq
MIRT2239772	hsa-miR-616	CLIP-seq
MIRT1036105	hsa-miR-620	CLIP-seq
MIRT2007202	hsa-miR-631	CLIP-seq
MIRT2007203	hsa-miR-632	CLIP-seq
MIRT1036107	hsa-miR-634	CLIP-seq
MIRT2239773	hsa-miR-640	CLIP-seq
MIRT1036026	hsa-miR-641	CLIP-seq
MIRT1036027	hsa-miR-655	CLIP-seq
MIRT2007206	hsa-miR-657	CLIP-seq
MIRT2007207	hsa-miR-668	CLIP-seq
MIRT2239774	hsa-miR-670	CLIP-seq
MIRT2239775	hsa-miR-671-5p	CLIP-seq
MIRT1036108	hsa-miR-761	CLIP-seq
MIRT1036109	hsa-miR-765	CLIP-seq
MIRT2007208	hsa-miR-767-3p	CLIP-seq
MIRT1036110	hsa-miR-874	CLIP-seq
MIRT2239776	hsa-miR-876-3p	CLIP-seq
MIRT1036111	hsa-miR-922	CLIP-seq
MIRT2007211	hsa-miR-92a	CLIP-seq
MIRT2007212	hsa-miR-92b	CLIP-seq
MIRT1036112	hsa-miR-93	CLIP-seq
MIRT2239777	hsa-miR-934	CLIP-seq
MIRT1036113	hsa-miR-935	CLIP-seq
MIRT1036114	hsa-miR-940	CLIP-seq
MIRT2239778	hsa-miR-943	CLIP-seq
MIRT2239779	hsa-miR-95	CLIP-seq
MIRT1035958	hsa-miR-1178	CLIP-seq
MIRT2007105	hsa-miR-1179	CLIP-seq
MIRT2239633	hsa-miR-1200	CLIP-seq
MIRT2239636	hsa-miR-1236	CLIP-seq
MIRT2239637	hsa-miR-1238	CLIP-seq
MIRT2239639	hsa-miR-1245	CLIP-seq
MIRT2239642	hsa-miR-1260	CLIP-seq
MIRT2239643	hsa-miR-1260b	CLIP-seq
MIRT1035959	hsa-miR-1284	CLIP-seq
MIRT1035961	hsa-miR-129-5p	CLIP-seq
MIRT1035962	hsa-miR-132	CLIP-seq
MIRT1035963	hsa-miR-1343	CLIP-seq
MIRT1036040	hsa-miR-142-5p	CLIP-seq
MIRT2239659	hsa-miR-188-3p	CLIP-seq
MIRT1036046	hsa-miR-18a	CLIP-seq
MIRT1036047	hsa-miR-18b	CLIP-seq
MIRT1035966	hsa-miR-212	CLIP-seq
MIRT1036052	hsa-miR-214	CLIP-seq
MIRT2007112	hsa-miR-25	CLIP-seq
MIRT1035969	hsa-miR-26a	CLIP-seq
MIRT1035970	hsa-miR-26b	CLIP-seq
MIRT2007114	hsa-miR-302f	CLIP-seq
MIRT2007117	hsa-miR-3122	CLIP-seq
MIRT2239677	hsa-miR-3156-3p	CLIP-seq
MIRT2007128	hsa-miR-32	CLIP-seq
MIRT1036058	hsa-miR-3202	CLIP-seq
MIRT1035987	hsa-miR-338-5p	CLIP-seq
MIRT2239685	hsa-miR-34c-3p	CLIP-seq
MIRT1036063	hsa-miR-3619-5p	CLIP-seq
MIRT2007133	hsa-miR-363	CLIP-seq
MIRT2007138	hsa-miR-367	CLIP-seq
MIRT2007140	hsa-miR-3684	CLIP-seq
MIRT2007141	hsa-miR-3689a-3p	CLIP-seq
MIRT2007142	hsa-miR-3689c	CLIP-seq
MIRT1035994	hsa-miR-374c	CLIP-seq
MIRT2007147	hsa-miR-3913-5p	CLIP-seq
MIRT2007148	hsa-miR-3935	CLIP-seq
MIRT1036066	hsa-miR-3942-3p	CLIP-seq
MIRT1036069	hsa-miR-4291	CLIP-seq
MIRT2239701	hsa-miR-4301	CLIP-seq
MIRT2239705	hsa-miR-4324	CLIP-seq
MIRT2007153	hsa-miR-4325	CLIP-seq
MIRT1036001	hsa-miR-4438	CLIP-seq
MIRT2007159	hsa-miR-4494	CLIP-seq
MIRT1036080	hsa-miR-4533	CLIP-seq
MIRT2007162	hsa-miR-4639-3p	CLIP-seq
MIRT1036010	hsa-miR-4704-5p	CLIP-seq
MIRT2007178	hsa-miR-4728-5p	CLIP-seq
MIRT1036086	hsa-miR-4735-3p	CLIP-seq
MIRT1036088	hsa-miR-4779	CLIP-seq
MIRT2239739	hsa-miR-483-3p	CLIP-seq
MIRT2239742	hsa-miR-496	CLIP-seq
MIRT2007189	hsa-miR-499a-5p	CLIP-seq
MIRT1036022	hsa-miR-5095	CLIP-seq
MIRT2239750	hsa-miR-544b	CLIP-seq
MIRT2007194	hsa-miR-577	CLIP-seq
MIRT1556476	hsa-miR-579	CLIP-seq
MIRT1036027	hsa-miR-655	CLIP-seq
MIRT2007207	hsa-miR-668	CLIP-seq
MIRT1036108	hsa-miR-761	CLIP-seq
MIRT1036111	hsa-miR-922	CLIP-seq
MIRT2007211	hsa-miR-92a	CLIP-seq
MIRT2007212	hsa-miR-92b	CLIP-seq
MIRT2239778	hsa-miR-943	CLIP-seq
MIRT1035958	hsa-miR-1178	CLIP-seq
MIRT2239639	hsa-miR-1245	CLIP-seq
MIRT1035976	hsa-miR-3136-3p	CLIP-seq
MIRT2429478	hsa-miR-3177-5p	CLIP-seq
MIRT1036001	hsa-miR-4438	CLIP-seq
MIRT1036022	hsa-miR-5095	CLIP-seq
MIRT2239662	hsa-miR-1914	CLIP-seq
MIRT1035969	hsa-miR-26a	CLIP-seq
MIRT1035970	hsa-miR-26b	CLIP-seq
MIRT2239674	hsa-miR-3074-5p	CLIP-seq
MIRT2239680	hsa-miR-323-5p	CLIP-seq
MIRT2239697	hsa-miR-3944-5p	CLIP-seq
MIRT2239708	hsa-miR-4456	CLIP-seq
MIRT2007174	hsa-miR-4715-3p	CLIP-seq
MIRT2007186	hsa-miR-4796-5p	CLIP-seq
MIRT2007191	hsa-miR-548an	CLIP-seq
MIRT2007195	hsa-miR-582-3p	CLIP-seq
MIRT2239776	hsa-miR-876-3p	CLIP-seq
MIRT2007130	hsa-miR-330-3p	CLIP-seq
MIRT2007143	hsa-miR-371-5p	CLIP-seq
MIRT2007144	hsa-miR-371b-5p	CLIP-seq
MIRT2007170	hsa-miR-4684-5p	CLIP-seq
MIRT1036017	hsa-miR-4768-5p	CLIP-seq
MIRT2007199	hsa-miR-607	CLIP-seq
MIRT1036037	hsa-miR-1286	CLIP-seq
MIRT1035975	hsa-miR-3124-3p	CLIP-seq
MIRT1036029	hsa-miR-889	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
CDX2	Unknown	24501326
CREB1	Unknown	11579131
NFKB1	Unknown	11579131
TFCP2	Unknown	16973241

188

Show/Hide all (188)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	25438055
GO:0000166	Function	Nucleotide binding	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	16096638
GO:0001837	Process	Epithelial to mesenchymal transition	IMP	15448698
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IMP	18156211
GO:0002020	Function	Protease binding	IPI	25118933
GO:0002039	Function	P53 binding	IDA	14744935
GO:0002183	Process	Cytoplasmic translational initiation	IDA	34731628
GO:0003170	Process	Heart valve development	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	16981698
GO:0004672	Function	Protein kinase activity	TAS	22988876, 24115276, 26049140
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8638126, 9072970, 11035810, 11104755, 11955436, 14744935, 15448698, 16315267, 17139249, 18348280, 19364825, 21343617, 25827072, 25897075, 28992046, 29059170, 29142209
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	16981698
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	8725894, 28386764
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	8638126, 9482734, 9601641, 9731200, 10481074, 11004522, 11035810, 11738041, 12421363, 12434148, 12927815, 14744935, 15147888, 15448698, 15752768, 16282323, 16365045, 16890161, 16981698, 17078951, 17139249, 17317006, 17318191, 17510365, 17601533, 18045539, 18505846, 18687691, 1884611
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12223487, 14744935, 15448698
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12223487, 14744935, 15448698, 18787224, 19038973, 20937854
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	17139249, 21399614
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	20937854
GO:0005886	Component	Plasma membrane	IEA
GO:0005977	Process	Glycogen metabolic process	IDA	8638126
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0006468	Process	Protein phosphorylation	IDA	20937854
GO:0006468	Process	Protein phosphorylation	IMP	16981698
GO:0006983	Process	ER overload response	IDA	14744935
GO:0007005	Process	Mitochondrion organization	IMP	25118933
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0007399	Process	Nervous system development	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008013	Function	Beta-catenin binding	IPI	8638126
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010508	Process	Positive regulation of autophagy	IBA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	26315788, 27050373
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IMP	27050373, 28122350
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	15448698, 25827072, 29059170
GO:0010975	Process	Regulation of neuron projection development	IBA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IMP	18156211
GO:0016301	Function	Kinase activity	IDA	15448698, 24391509
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	11104755, 14744935
GO:0019082	Process	Viral protein processing	IEA
GO:0019082	Process	Viral protein processing	TAS
GO:0019901	Function	Protein kinase binding	IPI	18348280
GO:0021766	Process	Hippocampus development	IMP	19581563
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0030010	Process	Establishment of cell polarity	TAS	18268107
GO:0030011	Process	Maintenance of cell polarity	ISS
GO:0030011	Process	Maintenance of cell polarity	TAS	18268107
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	35609316
GO:0030336	Process	Negative regulation of cell migration	IDA	27494834
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	ISS
GO:0030516	Process	Regulation of axon extension	ISS
GO:0030877	Component	Beta-catenin destruction complex	IBA
GO:0030877	Component	Beta-catenin destruction complex	IDA	8638126, 9601641, 16188939, 18593713
GO:0030877	Component	Beta-catenin destruction complex	IEA
GO:0030877	Component	Beta-catenin destruction complex	NAS	9601641
GO:0030877	Component	Beta-catenin destruction complex	TAS	11955436, 19366350
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	29142209
GO:0031175	Process	Neuron projection development	IDA	19830702
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	16188939
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	8638126
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	29142209
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21118991
GO:0032007	Process	Negative regulation of TOR signaling	IBA
GO:0032092	Process	Positive regulation of protein binding	ISS
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	34102342
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IC	11955436
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	19364825, 22660580
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	25897075
GO:0032886	Process	Regulation of microtubule-based process	IMP	20937854
GO:0034236	Function	Protein kinase A catalytic subunit binding	IEA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	11035810
GO:0034452	Function	Dynactin binding	IPI	17139249
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	21343617
GO:0035556	Process	Intracellular signal transduction	IDA	14749367
GO:0035556	Process	Intracellular signal transduction	TAS	26049140
GO:0036016	Process	Cellular response to interleukin-3	ISS
GO:0038203	Process	TORC2 signaling	IDA	21343617, 29424687
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	14744935
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15103331, 20389280, 23453970, 25827072, 29059170, 34518685
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	9601641
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0045597	Process	Positive regulation of cell differentiation	IMP	28122350
GO:0045668	Process	Negative regulation of osteoblast differentiation	IMP	24023731
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	IEA
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	TAS	19366350
GO:0045724	Process	Positive regulation of cilium assembly	ISS
GO:0045727	Process	Positive regulation of translation	IDA	34731628
GO:0045732	Process	Positive regulation of protein catabolic process	IC	16188939
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0046777	Process	Protein autophosphorylation	IDA	23184662
GO:0046825	Process	Regulation of protein export from nucleus	IDA	12223487
GO:0046825	Process	Regulation of protein export from nucleus	ISS
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	14744935
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048511	Process	Rhythmic process	IEA
GO:0048814	Process	Regulation of dendrite morphogenesis	ISS
GO:0050321	Function	Tau-protein kinase activity	IBA
GO:0050321	Function	Tau-protein kinase activity	IDA	14690523, 16365045
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050770	Process	Regulation of axonogenesis	ISS
GO:0051059	Function	NF-kappaB binding	IPI	15465828
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	9094314
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10428961, 16890161
GO:0060070	Process	Canonical Wnt signaling pathway	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	TAS
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	20864106
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	ISS
GO:0070885	Process	Negative regulation of calcineurin-NFAT signaling cascade	IMP	9072970
GO:0071109	Process	Superior temporal gyrus development	IMP	19581563
GO:0071300	Process	Cellular response to retinoic acid	IMP	28122350
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IC	9601641, 11955436
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	27846906
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	24023731
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	19366350
GO:0097110	Function	Scaffold protein binding	IPI	18593713
GO:0097191	Process	Extrinsic apoptotic signaling pathway	ISS
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	EXP	17989287
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IDA	17989287
GO:0098978	Component	Glutamatergic synapse	IMP	17989287
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	EXP	17989287
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IDA	17989287
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IMP	17989287
GO:0106027	Process	Neuron projection organization	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	IGI	30556160
GO:0140694	Process	Membraneless organelle assembly	ISS	35951695
GO:0150101	Process	Regulation of microtubule anchoring at centrosome	IMP	17139249
GO:0160213	Process	Beta-arrestin-dependent dopamine receptor signaling pathway	NAS	21711983
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1900181	Process	Negative regulation of protein localization to nucleus	ISS
GO:1900271	Process	Regulation of long-term synaptic potentiation	ISS
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	ISS
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	18846110
GO:1903566	Process	Positive regulation of protein localization to cilium	ISS
GO:1903940	Process	Negative regulation of TORC2 signaling	IDA	21343617
GO:1904339	Process	Negative regulation of dopaminergic neuron differentiation	TAS	24431302
GO:1904646	Process	Cellular response to amyloid-beta	ISS
GO:1904781	Process	Positive regulation of protein localization to centrosome	IMP	17139249
GO:1904951	Process	Positive regulation of establishment of protein localization	IEA
GO:1990909	Component	Wnt signalosome	TAS	24115276
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	24424410
GO:2000077	Process	Negative regulation of type B pancreatic cell development	IEA
GO:2000077	Process	Negative regulation of type B pancreatic cell development	TAS	19366350
GO:2000466	Process	Negative regulation of glycogen (starch) synthase activity	TAS	19366350
GO:2000740	Process	Negative regulation of mesenchymal stem cell differentiation	IMP	24023731

MIM	HGNC	e!Ensembl
605004	4617	ENSG00000082701

P49841

Protein name

Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)

Protein function

Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase

PDB

1GNG , 1H8F , 1I09 , 1J1B , 1J1C , 1O6K , 1O6L , 1O9U , 1PYX , 1Q3D , 1Q3W , 1Q41 , 1Q4L , 1Q5K , 1R0E , 1UV5 , 2JDO , 2JDR , 2JLD , 2O5K , 2OW3 , 2UW9 , 2X39 , 2XH5 , 3CQU , 3CQW , 3DU8 , 3E87 , 3E88 , 3E8D , 3F7Z , 3F88 , 3GB2 , 3I4B , 3L1S , 3M1S , 3MV5 , 3OW4 , 3PUP , 3Q3B , 3QKK , 3QKL , 3SAY , 3SD0 , 3ZDI , 3ZRK , 3ZRL , 3ZRM , 4ACC , 4ACD , 4ACG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	56 → 340	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis, thymus, prostate and ovary and weakly expressed in lung, brain and kidney. Colocalizes with EIF2AK2/PKR and TAU in the Alzheimer disease (AD) brain. {ECO:0000269|PubMed:21029237}.

Sequence

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Sequence length

420

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (41)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 6	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 6A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-INFANTILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID CIPOFUSCINOSIS TYPE 6	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary dilated cardiomyopathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (470)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	17409235, 22944069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	22785175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25812605, 28028966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22751450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16951223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21609933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27236820, 30496797, 30787996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	30637920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19148484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19148484, 21609933, 21880738, 21880954, 22562294, 22751121, 23129580, 24501326, 26992223, 28057765, 29238040, 30033597, 30554113, 30945380, 9601641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30417779, 31750236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30402836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	29997171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28028966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28321536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18852354, 19233276, 20080974, 21411544, 22180352, 22508715, 23279147, 23525328, 23809426, 25765079, 26194614, 26696252, 27077117, 27853238, 28025562 View all (17 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	17409235, 22944069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11326302, 21443865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	17409235, 22944069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	17409235, 22944069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29274321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	17409235, 22944069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28633346, 31381511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21181298, 25420549, 26086249, 28098243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24680562		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplasia	Anaplasia	BEFREE	28724942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30402833		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28639695, 31533931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23279147, 27825907, 30188517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	23279147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	23030648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27825907, 30188517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	31567019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	32768677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20888430, 21998135, 31662443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	39923112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29848990, 38272919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24065186, 28042322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28042322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32606150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20888430, 21998135, 31662443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29104639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32781864	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33028764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	16916907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	22243669	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	22658982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23809426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31749684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	27578017		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27771871, 29201232, 29363726, 30210588, 31400930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	30841855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	14729229, 15351432, 15694273, 16289845, 16733521, 20615089, 22990942, 23440732, 24677591, 24929537, 25041379, 25345732, 28099358, 28106616, 29283064 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	17621172		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	20357757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	21040291, 22990942, 24150227, 24677591, 24992082, 25041379, 28242499, 29561817, 29666369, 31769621	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22990942, 23440732, 24677591, 24929537, 24992082		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	23021822, 29433844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26844702, 29350680, 29863246, 31298320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	LHGDN	19237556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	25042561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19657367, 22174377, 25999350, 31769620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	36402441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	23666460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30703695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18708403, 22710837, 22976805, 23690508, 26618772, 26992223, 27494834, 28810530, 29655255, 30037362, 30181805, 30405781, 30417392, 31006103, 31119045, 31669347 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21044952, 23559006, 23959174, 24568493, 24903376, 26032359, 26246283, 26996066, 27045586, 27494834, 27983530, 28522609, 29968965, 30037362, 30196303 View all (11 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22773696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29407771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	28410220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34162041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19064714, 22179823, 29968965, 33682722, 34546849, 34719306, 35815408, 37020036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23023215, 34326276	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	19765735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19148484, 21317880, 23729362, 30405781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	19751508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	10391090, 10433945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15527765, 22911714, 23085750, 24302615, 25053419, 25157753, 25172662, 25940701, 26280346, 26498355, 26575170, 27901475, 28465479, 28639896, 28655132 View all (21 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16039586	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23432902	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26844702, 29350680, 29863246, 31298320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	28122350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23983127, 28237093, 28672902, 28849055, 29700285, 29877972, 30388099, 30709379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28097141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18254976, 26240274, 35327583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19920820, 21151099, 23433103, 25123268, 25757764, 27387559, 29228417, 30032137, 31298469, 31900208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	17972518	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	28766886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32402285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26526575, 28460311, 31289467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37852321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	19629191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	20525681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28216152, 28695302, 30070262, 30099338, 30237226, 31199069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	18478238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27866373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30336136, 30355116, 30981804, 31226691		★★★★★ ★☆☆☆☆ Found in Text Mining only
CEROID LIPOFUSCINOSIS, NEURONAL, 6	Neuronal ceroid lipofuscinosis	CTD_human_DG	23516525		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	28627610, 30532552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	27092879, 28627610, 30532552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28028966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25632187, 29436659, 32116234, 36853289, 37568083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28964793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37832404	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	29529390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	22246604, 23922104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31819479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29529390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28578881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	28714566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	26292722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	27412116, 28337318, 29968232, 30336136, 31226691, 31325596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	24634145		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	27077117, 37700547	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	28341347, 30310078, 30632435, 30704365, 30799178, 31685977		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	23729362, 24398687, 26352871, 28008149, 28718684, 31168297, 31338947, 31524255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17241872, 19190323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19338355, 25301365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21303975, 23431386, 23624843, 24303084, 24982245, 25002914, 26373808, 26398368, 27835604, 28057765, 29039496, 29978469, 30413483, 30618098, 30806153, 31062382 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16670426, 19064714, 19190323, 20110283, 20663927, 22581840, 23085750, 23431386, 23624843, 24151146, 24303084, 24398687, 25002914, 25738332, 26331352 View all (29 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	19022564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29221199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	17901358		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	27628899, 29563102		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22707636, 25123268, 27387559, 28846080, 29148041, 30032137, 31832810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28153944, 29171428, 30422891, 31486509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29431119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36444838	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	32630830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	18852354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	18852354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28488208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	20357757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	BEFREE	24677591		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Neurotic	Mental Depression	CTD_human_DG	20357757, 20534517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17628506, 28242499, 29036833, 29283064, 29291430, 29421716, 30699850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17628506, 21315744, 23188793		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	20357757, 20534517		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20618448, 28242499	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	20618448, 23030648, 23809426, 28242499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	20357757, 20534517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27769064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	27769064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35468861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23880101, 27534430, 28584284, 28609678, 29144001, 29208522, 29561817, 30902399, 31057171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	23974919, 24507683, 36698149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	25541965	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19754670, 20080974, 28916781, 29561817, 37700547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23880101, 27534430, 27896926, 28301953, 28584284, 28609678, 28633346, 28852393, 29144001, 29158110, 29171428, 29208522, 29561817, 30237226, 30902399, 31057171 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35628588	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	39464889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25157753, 27077117, 37700547, 40474205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29154192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25157753, 27530212, 27717746, 28225806, 30824102, 30949773, 31108940, 31609623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28216152, 30237226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23777469, 31467925, 31957842, 35129424, 40474205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23777469, 26849944, 27748847, 29201232, 31791666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	34564680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27534430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	20357757, 20534517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27050373, 30943930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	28747625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10076565, 19389926, 23943160, 29268772, 29724995, 31131636, 38096983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27050373	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25194152, 38146657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30943930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	24219064, 27838154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28595035, 29399113, 30502054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30502054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	27190311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22246236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	18609681, 22246236, 24022664, 26050229, 35201967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22246236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26045816, 31722716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	17409235, 22944069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	21238544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24469828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	24469828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24469828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	31808966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29529390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	30502054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	27775852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	18852354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	18852354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	36546234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	29301038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	28646232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	34940783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19823589, 20154711, 23715499, 25265336, 28042322, 29129566, 31037147, 33671112, 34072831, 35857445, 36076555, 36234681, 37779078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22262180, 23715499, 27654922, 28042322, 28423558, 28672195, 30814514, 31037147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22262180, 23715499, 27654922, 27792996, 28042322, 28423558, 28672195, 30814514, 31037147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19823589, 27802437, 28042322, 28499919, 31355268, 32533688, 32735016, 33637977, 34056009, 34462446, 34887392, 36944954, 37408388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22999562, 26388612, 31788110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	26320152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	33179111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	32735324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30405781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	33028764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	17901358		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	27628899, 29563102		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	17901358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	32781864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25645159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24811996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	24773279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	20066439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22531500, 27124580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27534430, 28427866, 30099338, 30400057, 31234955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28427866, 30017861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32888289	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22982863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	29148180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	28483784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	20190034, 20525681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy of tonsils	Hypertrophy Of Tonsils	BEFREE	29530430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31031016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12764143	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16513844, 21964756, 28486050, 32481626, 36539586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29843131, 35671789	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28256059, 28668375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18478089, 20061390, 22642910, 27218286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21398658, 24355211, 28337257, 28341347, 28352664, 28584284, 29137190, 29449801, 29804228, 30310078, 30336136, 30704365, 30787593, 30799178, 31057171 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22721429, 26604643, 27433090, 27702717, 36517007, 38102588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37409718	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	24425879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29642012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33090383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28591721, 30981804, 31640179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isovaleryl-CoA dehydrogenase deficiency	Isovaleryl-CoA dehydrogenase deficiency	BEFREE	25193986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18201972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29600538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	22785175		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	30919976, 31685087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	25757764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28122350, 29562960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	17901358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27565262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20352103, 21795403, 22207684, 24086728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27889234, 28251886, 29523407, 30740945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22751450, 25428027, 27248172, 28918518, 29515000, 34516354, 35370472, 36520954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	22751450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26766591, 30385433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	16174773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12603528, 12969793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21038412, 22110662, 22262416, 23085750, 24113128, 25157753, 25172662, 26359353, 26575170, 26683365, 28241806, 28548306, 28639896, 28655132, 28775779 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26826001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24811996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	27010852, 30630510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22110662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35418483	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17972518, 18701211, 22363707, 23761130, 24468793, 24498263, 26863455, 27015122, 28592245, 31136988, 32521874, 33099479, 33099905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28849055	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30709379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23735868, 36309313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18254976, 19528467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28562582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Lymphocytic, Intermediate	Lymphoma, Lymphocytic, Intermediate	CTD_human_DG	18787224		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16733521		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16733521		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16733521		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16733521		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	16733521		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	16733521		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	16733521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	30081294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18195729, 20033742, 20219685, 20618448, 20682308, 23030648, 24677591, 24927694, 26186530, 28099358, 30080747, 30310078, 31111219, 31189175		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20618448, 23030648, 24001941, 24677591, 24927694		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30405781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	18787224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	CTD_human_DG	18787224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18708403, 21757741, 22710837, 22976805, 23690508, 26618772, 26992223, 27494834, 28810530, 29655255, 30037362, 30181805, 30405781, 30417392, 31006103, 31119045, 31669347 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27050373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22246236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	23582741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	28122350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23983127, 28237093, 28672902, 28849055, 29700285, 29877972, 30388099, 30709379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26526575, 28460311, 31289467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21441955, 21628454, 22100174, 26823495, 28764929, 29949874, 30144430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	31574243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14985354, 18852124, 21111724, 21613824, 22539113, 27588482, 27620488, 29389061, 31104320, 31480051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16421604, 25246272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22970250, 25846563, 29030742, 29196265, 29306955, 29364479, 29393470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26844702, 29350680, 29863246, 31298320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20204404, 20473943, 21111724, 21441955, 22849606, 22999562, 23715499, 23943362, 25157753, 27486911, 27780915, 28053024, 28460311, 28775779, 28857252 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28627610, 30532552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21609933, 23729362, 24398687, 26352871, 28008149, 28718684, 31168297, 31338947, 31524255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	20357757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	21549170, 28242499, 29860313, 30027342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	20357757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	31750236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	17016438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23525311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	20357757, 20534517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10699468, 17991738, 22810307, 24034838, 28410220, 33875769, 34224305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17991738		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21929745, 27470346, 28605165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	BEFREE	28633346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25864108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17628506, 27825907, 28242499, 29036833, 29283064, 29291430, 29421716, 30699850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	17628506, 21315744, 23188793		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	26186530, 28337318, 28720858, 29298990, 29421716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	17325032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28296937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27986275, 29523407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30134822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32276265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22785398, 30738142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24303084, 24811996, 28930531, 28935982, 31930701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28126496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	17976739		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	20113358, 20618448, 28242499, 29666369	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	20219685, 20618448, 28242499, 30080747, 30081294, 30310078, 31153593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	20219685, 20618448		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	BEFREE	30310078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	26292722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	24680562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25645517, 27696293, 32606150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CTD_human_DG	22975441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19657367, 20920357, 33469678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	31123295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26766591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	26521017	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	19237556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22262776, 23233089, 27538509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	17901358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	16716347		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	24899689, 28130118, 28720397, 29940198, 30203709, 30323868		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28153944, 28421373, 29171428, 30422891, 31486509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	37656238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia	Myotonia	Pubtator	33682722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28915272, 33682722, 37445828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	29203592, 31383751		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31383751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	28714566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28714566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21207227, 21571466, 23874688, 27769064, 27891591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23874688, 27769064, 29516971, 33068388, 37070291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26032359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21161565, 21441955, 21837368, 21860426, 22100174, 22534782, 22539113, 23575666, 23649588, 23729362, 23851495, 23874688, 24268141, 24333432, 24352760 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	25535399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27832289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17379415, 21499833, 23900341, 24521712, 24618834, 30755485, 30868061, 39289439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20920551, 21161565, 27255602, 27434867, 27896926, 28591721, 29309769, 29846250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	18852354, 23646926, 23809426, 23951236, 30935413, 31123295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15132987, 21352912, 27378458, 27412761, 28111255, 29449801, 30237424, 31123295, 31561361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	15132987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	25535399, 29117336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24132507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23851495, 24618715, 25026278, 28419994, 29029423, 29039479, 29793508, 30666163, 30709379, 30793366, 31819514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16355479, 31412932, 35470975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26618897	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29398139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	27769064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26618897	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33468167, 34856957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	33179111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28617442, 28731198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	28916781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	BEFREE	28866105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20926002, 22534782, 23164673, 24333432, 24391455, 27780915, 28790389, 29323740, 29546355, 30142548, 30737824, 31595984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24391455, 25973047, 29863240, 33969873, 35112982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29603383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23840442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16788573		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26526575, 28460311, 31289467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14520463, 23667667, 25643607, 26526575, 27051274, 27562816, 29758922, 31277702, 31983100, 32706063, 35768865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21441955, 21628454, 22100174, 26823495, 28764929, 29949874, 30144430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15609321, 16951223, 17912008, 18829575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	30144430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18829575, 19338355, 19920820, 19966835, 22829912, 23992308, 26240274, 27481517, 35327583, 35929518, 36743929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	31750236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	19148484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16315267, 19573950, 21130530, 21159074, 22815195, 23628795, 24586351, 24681994, 24779391, 25394490, 27853238, 27977132, 28488766, 28569794, 29190615 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	16315267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	20599975, 24586351, 24779391, 27503909, 27853238, 31123295, 31234232, 31930701, 35053314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31234232	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	30678114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24675460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29107899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	29117336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29107899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30417779, 31750236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	18852354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	25629553, 27190311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17270183, 18768676, 21300347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	17270183, 18768676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	18178198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	15676208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	25812605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	17409235, 22944069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Peritonitis	Peritonitis	CTD_human_DG	16713974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	30046527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14985354, 18852124, 21111724, 21613824, 22539113, 27588482, 27620488, 29389061, 31104320, 31480051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12900420, 14617795, 18852124		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14985354, 17522055, 18395973, 18687691, 19528467, 20368692, 20537156, 21613824, 21980429, 22493441, 25349215, 26252009, 27588482, 28614631, 30134822 View all (7 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16421604, 25246272		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22539113		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	31074061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28888361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20190034, 26787464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26320152, 29463070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28720386, 31471107, 31831767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	20219685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31298469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21151099, 22707636, 25123268, 27387559, 29148041, 31298469, 31832810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	30964179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	39738380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	29742424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28968964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21910999, 29431119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	35005835	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37793334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	23023215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	27780915		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	34681807	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	14518171, 15254796, 15719395, 16987250, 17368486, 18500637		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	14745448, 31563592		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15719395, 16289845, 17368486, 20113358, 20615089, 22832527, 23160851, 23440732, 23598903, 25041379, 25380769, 26186530, 27055860, 27996211, 28099358 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19457211, 20113358, 23809426, 23951236, 25041379	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary Peritonitis	Peritonitis	CTD_human_DG	16713974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31503410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	28197936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome 1 Autosomal Recessive	Sick sinus syndrome	Pubtator	32781864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	35154161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30832755, 35838343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28548834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	30402833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20878057, 26315788, 29134466, 29176314, 30405781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28574599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21393552, 25591548, 25622907, 28671055, 30556871, 31583913, 32899202, 34564680, 37291150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29944884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26399460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30237424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31234955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22970250, 25846563, 29030742, 29196265, 29306955, 29364479, 29393470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16371352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16371352, 19060929, 20704706, 21439087, 22325465, 22970250, 25338767, 26934444, 27323966, 28345638, 28745795, 29222406, 29306955, 29393470, 29436606 View all (12 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21519918	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29364479	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	27769064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	27769064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	29561817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26820677, 28457811, 29556174		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	31808966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21873331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	20615469, 22922102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	CTD_human_DG	26945731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	24603331, 27854077, 29766503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	19552924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	19223551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30272290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27487122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Timothy syndrome	Timothy Syndrome	BEFREE	28646232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25645517, 26036631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	28349361, 28553165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28349361, 28553165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Stenosis	Tricuspid Valve Stenosis	BEFREE	28646232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26236947, 30845991, 40613296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28480051, 31071331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	27918305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	28646232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20033742, 20618448, 20682308, 26186530, 31189175, 31742842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	20357757, 20534517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25349215, 26844702, 28337959, 29863246, 31298320, 36331809, 37366889	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20178594, 26560046, 28835320, 35609330, 38056236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31465717	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	28747625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	30146633		★★★★★ ★☆☆☆☆ Found in Text Mining only

GSK3B (glycogen synthase kinase 3 beta)