Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	400581
Gene name	GRB2 related adaptor protein like
Gene symbol	GRAPL
Synonyms (NCBI Gene)	GRAPLDR
Chromosome	17
Chromosome location	17p11.2

22 Show/Hide all (22)

miRTarBase ID	miRNA	Experiments
MIRT1032966	hsa-miR-1286	CLIP-seq
MIRT1032967	hsa-miR-302a	CLIP-seq
MIRT1032968	hsa-miR-302b	CLIP-seq
MIRT1032969	hsa-miR-302c	CLIP-seq
MIRT1032970	hsa-miR-302d	CLIP-seq
MIRT1032971	hsa-miR-302e	CLIP-seq
MIRT1032972	hsa-miR-372	CLIP-seq
MIRT1032973	hsa-miR-373	CLIP-seq
MIRT1032974	hsa-miR-4294	CLIP-seq
MIRT1032975	hsa-miR-4433	CLIP-seq
MIRT1032976	hsa-miR-4694-3p	CLIP-seq
MIRT1032977	hsa-miR-4722-5p	CLIP-seq
MIRT1032978	hsa-miR-520a-3p	CLIP-seq
MIRT1032979	hsa-miR-520b	CLIP-seq
MIRT1032980	hsa-miR-520c-3p	CLIP-seq
MIRT1032981	hsa-miR-520d-3p	CLIP-seq
MIRT1032982	hsa-miR-520e	CLIP-seq
MIRT1032983	hsa-miR-520f	CLIP-seq
MIRT1032984	hsa-miR-636	CLIP-seq
MIRT1032985	hsa-miR-642a	CLIP-seq
MIRT1032986	hsa-miR-765	CLIP-seq
MIRT1032976	hsa-miR-4694-3p	CLIP-seq

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IBA
GO:0016477	Process	Cell migration	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0035591	Function	Signaling adaptor activity	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein name

GRB2-related adapter protein-like

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	60 → 115	SH2 domain	Domain
PF00018	SH3_1	4 → 50	SH3 domain	Domain

Sequence

MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPW
YSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNNRAQRGPCLGPKSHSRLG

Sequence length

118

Interactions

View interactions

Related Genes Genes most often co-reported with GRAPL across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for GRAPL.

Diseases Linked via Similar Genes Diseases curated for genes most similar to GRAPL (see Related Genes above), that are NOT already directly curated for GRAPL itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to GRAPL.

GRAPL (GRB2 related adaptor protein like)