GPR62 (G protein-coupled receptor 62)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 118442
• Gene name: G protein-coupled receptor 62
• Gene symbol: GPR62
• Synonyms (NCBI Gene): GPCR8, KPG_005
• Chromosome: 3
• Chromosome location: 3p21.2

miRNA Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1031595	hsa-miR-1301	CLIP-seq
MIRT1031596	hsa-miR-198	CLIP-seq
MIRT1031597	hsa-miR-199a-3p	CLIP-seq
MIRT1031598	hsa-miR-199b-3p	CLIP-seq
MIRT1031599	hsa-miR-2355-3p	CLIP-seq
MIRT1031600	hsa-miR-3129-5p	CLIP-seq
MIRT1031601	hsa-miR-3690	CLIP-seq
MIRT1031602	hsa-miR-4254	CLIP-seq
MIRT1031603	hsa-miR-4646-3p	CLIP-seq
MIRT1031604	hsa-miR-4660	CLIP-seq
MIRT1031605	hsa-miR-4751	CLIP-seq
MIRT1031606	hsa-miR-5047	CLIP-seq
MIRT1031607	hsa-miR-765	CLIP-seq
MIRT1031608	hsa-miR-936	CLIP-seq
MIRT2238551	hsa-miR-3682-5p	CLIP-seq
MIRT2450645	hsa-miR-1285	CLIP-seq
MIRT2450646	hsa-miR-3187-5p	CLIP-seq
MIRT2450647	hsa-miR-3665	CLIP-seq
MIRT2450648	hsa-miR-378g	CLIP-seq
MIRT2450649	hsa-miR-3945	CLIP-seq
MIRT2450650	hsa-miR-4253	CLIP-seq
MIRT2450651	hsa-miR-4486	CLIP-seq
MIRT2450652	hsa-miR-612	CLIP-seq
MIRT1031607	hsa-miR-765	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	28827538
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IDA	28827538
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28827538
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0038035	Process	Ligand-independent adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	28827538
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	28827538
GO:1990763	Function	Arrestin family protein binding	IDA	28827538

Other IDs

• MIM: 606917
• HGNC: 13301
• e!Ensembl: ENSG00000180929

Protein

• UniProt ID: Q9BZJ7
• Protein name: G-protein coupled receptor 62 (G-protein coupled receptor GPCR8) (hGPCR8) (G-protein coupled receptor KPG_005)
• Protein function: Orphan G-protein coupled receptor. Constitutively activates the G(q/11)/inositol phosphate and the G(s)-alpha/cAMP signaling pathways (PubMed:28827538). Has spontaneous activity for beta-arrestin recruitment (PubMed:28827538). Shows a reciprocal
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	31 → 290	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain; detected in the basal forebrain, frontal cortex, caudate, putamen, thalamus and hippocampus. {ECO:0000269|PubMed:11165367}.
• Sequence:

  MANSTGLNASEVAGSLGLILAAVVEVGALLGNGALLVVVLRTPGLRDALYLAHLCVVDLL
  AAASIMPLGLLAAPPPGLGRVRLGPAPCRAARFLSAALLPACTLGVAALGLARYRLIVHP
  LRPGSRPPPVLVLTAVWAAAGLLGALSLLGTPPAPPPAPARCSVLAGGLGPFRPLWALLA
  FALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAA
  LAPALAVGQFAACWLPYGCACLAPAARAAEAEAAVTWVAYSAFAAHPFLYGLLQRPVRLA
  LGRLSRRALPGPVRACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQ
  GPPESSLS

• Sequence length: 368

Related Genes

No strongly related genes found yet for GPR62.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GPR62.