GPR32P1 (GPR32 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 2855
Gene name GPR32 pseudogene 1
Gene symbol GPR32P1
Synonyms (NCBI Gene)
GPR32PhGPCR39
Chromosome 19
Chromosome location 19q13.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002430 Process Complement receptor mediated signaling pathway IBA
GO:0004875 Function Complement receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004982 Function N-formyl peptide receptor activity IBA
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 4488 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NGA4
Protein name Putative G-protein coupled receptor GPR32P1 (G-protein coupled 32 pseudogene) (G-protein coupled 32 pseudogene 1) (G-protein coupled receptor GPCR39) (hGPCR39)
Protein function Orphan receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 60 → 256 7 transmembrane receptor (rhodopsin family) Family
Sequence 
MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLG
NGLVPWVTVFRMARTVSTVCFFHLALADFMLSLSLPILVYYIVSRQWLLGEWACKLYTGF
VFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFR
TTRKWNGCMQCYLQFNLENETAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIR
AKLLREGWVHANRPKRLLLVLVSALSAGSHLT
Sequence length 272
Interactions View interactions

No strongly related genes found yet for GPR32P1.

No additional diseases found yet through genes similar to GPR32P1.