GPR171 (G protein-coupled receptor 171)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29909
• Gene name: G protein-coupled receptor 171
• Gene symbol: GPR171
• Synonyms (NCBI Gene): H963
• Chromosome: 3
• Chromosome location: 3q25.1

miRNA Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT641224	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT641223	hsa-miR-607	HITS-CLIP	23824327
MIRT641224	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT641223	hsa-miR-607	HITS-CLIP	23824327
MIRT2450614	hsa-miR-138	CLIP-seq
MIRT2450615	hsa-miR-3160-5p	CLIP-seq
MIRT2450616	hsa-miR-4417	CLIP-seq
MIRT2450617	hsa-miR-4456	CLIP-seq
MIRT2450618	hsa-miR-4490	CLIP-seq
MIRT2450619	hsa-miR-4774-5p	CLIP-seq
MIRT2450620	hsa-miR-541	CLIP-seq
MIRT2450621	hsa-miR-654-5p	CLIP-seq
MIRT2542440	hsa-miR-223	CLIP-seq
MIRT2542441	hsa-miR-4277	CLIP-seq
MIRT2542442	hsa-miR-4645-5p	CLIP-seq
MIRT2542443	hsa-miR-4673	CLIP-seq

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	NAS	9370294
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	9370294
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0008188	Function	Neuropeptide receptor activity	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9370294
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0042923	Function	Neuropeptide binding	IEA
GO:0042923	Function	Neuropeptide binding	ISS
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IBA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0051930	Process	Regulation of sensory perception of pain	ISS
GO:0060259	Process	Regulation of feeding behavior	IEA
GO:0060259	Process	Regulation of feeding behavior	ISS

Other IDs

• MIM: 618925
• HGNC: 30057
• e!Ensembl: ENSG00000174946

Protein

• UniProt ID: O14626
• Protein name: G-protein coupled receptor 171 (G-protein coupled receptor H963)
• Protein function: G-protein coupled receptor for Big LEN, a 16-amino acid neuropeptide produced from the precursor protein, proSAAS (encoded by PCSK1N). Acts through a G(i)-alpha-mediated pathway in response to Big LEN. Big LEN-GPR171 system plays an important ro
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	31 → 285	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in both T-cell subsets and natural killer cells, while it is undetectable in B cells or CD14(+) monocytes. Expressed in peripheral blood mononuclear cells (PBMC) and Jurkat cells (at protein level). {ECO:0000269|PubMed:346158
• Sequence:

  MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTAD
  FLLTLALPVKIVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSC
  KIYRIQEPGFAKMISTVVWLMVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLT
  NFICVAIFLNFSAIILISNCLVIRQLYRNKDNENYPNVKKALINILLVTTGYIICFVPYH
  IVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRSKVTETF
  ASPKETKAQKEKLRCENNA

• Sequence length: 319

Related Genes

No strongly related genes found yet for GPR171.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GPR171.