GPR15LG (G protein-coupled receptor 15 ligand)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 387695
• Gene name: G protein-coupled receptor 15 ligand
• Gene symbol: GPR15LG
• Synonyms (NCBI Gene): AP-57, AP57, C10orf99, CSBF, GPR15L, UNQ1833
• Chromosome: 10
• Chromosome location: 10q23.1

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017294	hsa-miR-335-5p	Microarray	18185580
MIRT829368	hsa-miR-3180-5p	CLIP-seq
MIRT829369	hsa-miR-338-3p	CLIP-seq
MIRT829370	hsa-miR-4433	CLIP-seq
MIRT829371	hsa-miR-4459	CLIP-seq
MIRT829372	hsa-miR-4530	CLIP-seq
MIRT829373	hsa-miR-4695-5p	CLIP-seq
MIRT829374	hsa-miR-4768-3p	CLIP-seq
MIRT829375	hsa-miR-4771	CLIP-seq
MIRT829376	hsa-miR-922	CLIP-seq
MIRT1945542	hsa-miR-516b	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IDA	28900043, 28936214
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	25351403, 28936214, 33758080
GO:0005576	Component	Extracellular region	IDA	25351403, 25585381
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	25585381
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	28900043, 28936214
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	34239069
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0008009	Function	Chemokine activity	IDA	28936214
GO:0008009	Function	Chemokine activity	IEA
GO:0010837	Process	Regulation of keratinocyte proliferation	IMP	29872130
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043029	Process	T cell homeostasis	IDA	28900043
GO:0043303	Process	Mast cell degranulation	IMP	35704588
GO:0048018	Function	Receptor ligand activity	IDA	28900043
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048247	Process	Lymphocyte chemotaxis	IDA	28936214
GO:0048247	Process	Lymphocyte chemotaxis	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	25585381
GO:0050832	Process	Defense response to fungus	IDA	25585381
GO:0051782	Process	Negative regulation of cell division	IDA	25351403, 25585381
GO:0072678	Process	T cell migration	IDA	20829352, 38918398
GO:0072678	Process	T cell migration	IDA	38918398
GO:1902807	Process	Negative regulation of cell cycle G1/S phase transition	IDA	25351403
GO:2000404	Process	Regulation of T cell migration	IDA	28900043

Other IDs

• MIM: 617775
• HGNC: 31428
• e!Ensembl: ENSG00000188373

Protein

• UniProt ID: Q6UWK7
• Protein name: Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99)
• Protein function: Highly cationic protein that has multiple functions. Acts as a chemotactic factor that mediates lymphocytes recruitment to epithelia through binding and activation of the G-protein coupled receptor GPR15 (PubMed:28900043, PubMed:28936214). May b
• PDB: 8ZQE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15854	GPR15L	1 → 80	G-protein coupled receptor ligand 15	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in colon, and cervix and at moderate level in tonsil (PubMed:25585381, PubMed:28900043). Highly reduced expression in primary colon cancer tissues compared with that in adjacent tissues (PubMed:25351403). Highe
• Sequence:

  MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLC
  KPCKLEPEPRLWVVPGALPQV

• Sequence length: 81

Related Genes

No strongly related genes found yet for GPR15LG.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GPR15LG.