GPHB5 (glycoprotein hormone subunit beta 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 122876
Gene name Glycoprotein hormone subunit beta 5
Gene symbol GPHB5
Synonyms (NCBI Gene)
B5GPB5ZLUT1
Chromosome 14
Chromosome location 14q23.2
Summary GPHB5 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family (Hsu et al., 2002 [PubMed 12089349]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019344 hsa-miR-148b-3p Microarray 17612493
MIRT023296 hsa-miR-122-5p Microarray 17612493
MIRT1029286 hsa-miR-3147 CLIP-seq
MIRT1029287 hsa-miR-4259 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002155 Process Regulation of thyroid hormone receptor signaling pathway IBA
GO:0002155 Process Regulation of thyroid hormone receptor signaling pathway IEA
GO:0005102 Function Signaling receptor binding IEA
GO:0005179 Function Hormone activity IEA
GO:0005515 Function Protein binding IPI 12045258, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609652 18055 ENSG00000179600
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86YW7
Protein name Glycoprotein hormone beta-5 (Thyrostimulin subunit beta)
Protein function Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. {ECO:00002
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00007 Cys_knot 33 → 130 Cystine-knot domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain and at low levels in pituitary. Also found in retina, testis and skin but not in pancreas, parotid, kidney, stomach, liver, colon, small intestine, thyroid, brain or adrenal gland. In pituitary, colocalizes wi
Sequence 
MKLAFLFLGPMALLLLAGYGCVLGASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDAC
WGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGAC
STATTECETI
Sequence length 130
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
cAMP signaling pathway Hormone ligand-binding receptors
Neuroactive ligand-receptor interaction G alpha (s) signalling events
  ADORA2B mediated anti-inflammatory cytokines production
Sort by:
GPHA2 4 shared pathwayscAMP signaling pathway, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Hormone ligand-binding receptors Related via 4 shared pathways including cAMP signaling pathway, G alpha (s) signalling events. FSHR 4 shared pathwayscAMP signaling pathway, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Hormone ligand-binding receptors Related via 4 shared pathways including cAMP signaling pathway, G alpha (s) signalling events. FSHB 4 shared pathwayscAMP signaling pathway, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Hormone ligand-binding receptors Related via 4 shared pathways including cAMP signaling pathway, G alpha (s) signalling events. GIPR 3 shared pathwayscAMP signaling pathway, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production Related via 3 shared pathways including cAMP signaling pathway, G alpha (s) signalling events. LHCGR 4 shared pathwayscAMP signaling pathway, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Hormone ligand-binding receptors Related via 4 shared pathways including cAMP signaling pathway, G alpha (s) signalling events.
Polycystic ovary syndrome Linked via 3 of 5 related genesFSHR, GIPR, LHCGR Hypogonadism Linked via 2 of 5 related genesFSHB, LHCGR Male infertility Linked via 2 of 5 related genesFSHB, LHCGR Metabolic syndrome Linked via 2 of 5 related genesGIPR, LHCGR Diabetes mellitus type 2 Linked via 2 of 5 related genesGIPR, LHCGR