Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	2817
Gene name	Glypican 1
Gene symbol	GPC1
Synonyms (NCBI Gene)	glypican
Chromosome	2
Chromosome location	2q37.3
Summary	Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protei

181

Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022703	hsa-miR-124-3p	Microarray	18668037
MIRT023811	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT054857	hsa-miR-149-5p	Luciferase reporter assayqRT-PCRWestern blot	24463821
MIRT054858	hsa-miR-149-3p	Luciferase reporter assayqRT-PCRWestern blot	24463821
MIRT054858	hsa-miR-149-3p	qRT-PCRWestern blotMTT	28233416
MIRT734395	hsa-miR-125b-5p	Luciferase reporter assayWestern blotting	32435510
MIRT1028528	hsa-miR-1226	CLIP-seq
MIRT1028529	hsa-miR-1271	CLIP-seq
MIRT1028530	hsa-miR-15a	CLIP-seq
MIRT1028531	hsa-miR-15b	CLIP-seq
MIRT1028532	hsa-miR-16	CLIP-seq
MIRT1028533	hsa-miR-182	CLIP-seq
MIRT1028534	hsa-miR-1910	CLIP-seq
MIRT1028535	hsa-miR-195	CLIP-seq
MIRT1028536	hsa-miR-223	CLIP-seq
MIRT1028537	hsa-miR-298	CLIP-seq
MIRT1028538	hsa-miR-3133	CLIP-seq
MIRT1028539	hsa-miR-330-3p	CLIP-seq
MIRT1028540	hsa-miR-338-3p	CLIP-seq
MIRT1028541	hsa-miR-3613-5p	CLIP-seq
MIRT1028542	hsa-miR-3689a-3p	CLIP-seq
MIRT1028543	hsa-miR-3689c	CLIP-seq
MIRT1028544	hsa-miR-371b-5p	CLIP-seq
MIRT1028545	hsa-miR-424	CLIP-seq
MIRT1028546	hsa-miR-4459	CLIP-seq
MIRT1028547	hsa-miR-4494	CLIP-seq
MIRT1028548	hsa-miR-4530	CLIP-seq
MIRT1028549	hsa-miR-4648	CLIP-seq
MIRT1028550	hsa-miR-4654	CLIP-seq
MIRT1028551	hsa-miR-4667-3p	CLIP-seq
MIRT1028552	hsa-miR-4691-5p	CLIP-seq
MIRT1028553	hsa-miR-4697-3p	CLIP-seq
MIRT1028554	hsa-miR-4728-5p	CLIP-seq
MIRT1028555	hsa-miR-4733-3p	CLIP-seq
MIRT1028556	hsa-miR-4765	CLIP-seq
MIRT1028557	hsa-miR-4769-5p	CLIP-seq
MIRT1028558	hsa-miR-497	CLIP-seq
MIRT1028559	hsa-miR-499a-5p	CLIP-seq
MIRT1028560	hsa-miR-542-3p	CLIP-seq
MIRT1028561	hsa-miR-766	CLIP-seq
MIRT1028562	hsa-miR-888	CLIP-seq
MIRT1028563	hsa-miR-922	CLIP-seq
MIRT1028564	hsa-miR-96	CLIP-seq
MIRT1921627	hsa-miR-1205	CLIP-seq
MIRT1921628	hsa-miR-1286	CLIP-seq
MIRT1921629	hsa-miR-3691-3p	CLIP-seq
MIRT1921630	hsa-miR-4722-5p	CLIP-seq
MIRT1921627	hsa-miR-1205	CLIP-seq
MIRT1921628	hsa-miR-1286	CLIP-seq
MIRT1921629	hsa-miR-3691-3p	CLIP-seq
MIRT1921630	hsa-miR-4722-5p	CLIP-seq
MIRT2005101	hsa-miR-1197	CLIP-seq
MIRT1921627	hsa-miR-1205	CLIP-seq
MIRT2005102	hsa-miR-1207-5p	CLIP-seq
MIRT2005103	hsa-miR-1266	CLIP-seq
MIRT1921628	hsa-miR-1286	CLIP-seq
MIRT2005104	hsa-miR-1291	CLIP-seq
MIRT2005105	hsa-miR-136	CLIP-seq
MIRT2005106	hsa-miR-146b-3p	CLIP-seq
MIRT2005107	hsa-miR-1470	CLIP-seq
MIRT1028534	hsa-miR-1910	CLIP-seq
MIRT2005108	hsa-miR-1913	CLIP-seq
MIRT2005109	hsa-miR-214	CLIP-seq
MIRT2005110	hsa-miR-22	CLIP-seq
MIRT2005111	hsa-miR-296-5p	CLIP-seq
MIRT1028537	hsa-miR-298	CLIP-seq
MIRT2005112	hsa-miR-3064-5p	CLIP-seq
MIRT2005113	hsa-miR-3115	CLIP-seq
MIRT2005114	hsa-miR-3117-5p	CLIP-seq
MIRT2005115	hsa-miR-3127-3p	CLIP-seq
MIRT2005116	hsa-miR-3144-5p	CLIP-seq
MIRT2005117	hsa-miR-3173-5p	CLIP-seq
MIRT2005118	hsa-miR-3187-3p	CLIP-seq
MIRT2005119	hsa-miR-324-3p	CLIP-seq
MIRT1028540	hsa-miR-338-3p	CLIP-seq
MIRT2005120	hsa-miR-3591-3p	CLIP-seq
MIRT2005121	hsa-miR-361-3p	CLIP-seq
MIRT2005122	hsa-miR-3619-5p	CLIP-seq
MIRT2005123	hsa-miR-3649	CLIP-seq
MIRT2005124	hsa-miR-3675-5p	CLIP-seq
MIRT1028542	hsa-miR-3689a-3p	CLIP-seq
MIRT1028543	hsa-miR-3689c	CLIP-seq
MIRT1921629	hsa-miR-3691-3p	CLIP-seq
MIRT2005125	hsa-miR-3918	CLIP-seq
MIRT2005126	hsa-miR-4252	CLIP-seq
MIRT2005127	hsa-miR-4290	CLIP-seq
MIRT2005128	hsa-miR-4313	CLIP-seq
MIRT2005129	hsa-miR-4435	CLIP-seq
MIRT2005130	hsa-miR-4436a	CLIP-seq
MIRT2005131	hsa-miR-4447	CLIP-seq
MIRT1028546	hsa-miR-4459	CLIP-seq
MIRT2005132	hsa-miR-4472	CLIP-seq
MIRT2005133	hsa-miR-4476	CLIP-seq
MIRT2005134	hsa-miR-4518	CLIP-seq
MIRT1028548	hsa-miR-4530	CLIP-seq
MIRT2005135	hsa-miR-4533	CLIP-seq
MIRT2005136	hsa-miR-4650-5p	CLIP-seq
MIRT2005137	hsa-miR-4651	CLIP-seq
MIRT1028551	hsa-miR-4667-3p	CLIP-seq
MIRT2005138	hsa-miR-4671-5p	CLIP-seq
MIRT2005139	hsa-miR-4690-5p	CLIP-seq
MIRT1028552	hsa-miR-4691-5p	CLIP-seq
MIRT2005140	hsa-miR-4701-5p	CLIP-seq
MIRT1921630	hsa-miR-4722-5p	CLIP-seq
MIRT1028554	hsa-miR-4728-5p	CLIP-seq
MIRT2005141	hsa-miR-4732-3p	CLIP-seq
MIRT2005142	hsa-miR-4736	CLIP-seq
MIRT2005143	hsa-miR-4752	CLIP-seq
MIRT2005144	hsa-miR-4763-3p	CLIP-seq
MIRT2005145	hsa-miR-4795-3p	CLIP-seq
MIRT2005146	hsa-miR-485-3p	CLIP-seq
MIRT2005147	hsa-miR-548s	CLIP-seq
MIRT2005148	hsa-miR-566	CLIP-seq
MIRT2005149	hsa-miR-588	CLIP-seq
MIRT2005150	hsa-miR-608	CLIP-seq
MIRT2005151	hsa-miR-626	CLIP-seq
MIRT2005152	hsa-miR-661	CLIP-seq
MIRT2005153	hsa-miR-761	CLIP-seq
MIRT2005154	hsa-miR-765	CLIP-seq
MIRT1028561	hsa-miR-766	CLIP-seq
MIRT2005155	hsa-miR-874	CLIP-seq
MIRT1028563	hsa-miR-922	CLIP-seq
MIRT2005101	hsa-miR-1197	CLIP-seq
MIRT2237785	hsa-miR-1207-3p	CLIP-seq
MIRT2005103	hsa-miR-1266	CLIP-seq
MIRT2237786	hsa-miR-1321	CLIP-seq
MIRT2005106	hsa-miR-146b-3p	CLIP-seq
MIRT1028534	hsa-miR-1910	CLIP-seq
MIRT2005109	hsa-miR-214	CLIP-seq
MIRT2005114	hsa-miR-3117-5p	CLIP-seq
MIRT2237787	hsa-miR-3127-5p	CLIP-seq
MIRT2005116	hsa-miR-3144-5p	CLIP-seq
MIRT2005117	hsa-miR-3173-5p	CLIP-seq
MIRT2005118	hsa-miR-3187-3p	CLIP-seq
MIRT2005122	hsa-miR-3619-5p	CLIP-seq
MIRT2005123	hsa-miR-3649	CLIP-seq
MIRT2237788	hsa-miR-3689d	CLIP-seq
MIRT2005125	hsa-miR-3918	CLIP-seq
MIRT2005126	hsa-miR-4252	CLIP-seq
MIRT2237789	hsa-miR-4270	CLIP-seq
MIRT2005129	hsa-miR-4435	CLIP-seq
MIRT2237790	hsa-miR-4441	CLIP-seq
MIRT2237791	hsa-miR-4446-3p	CLIP-seq
MIRT2005131	hsa-miR-4447	CLIP-seq
MIRT1028546	hsa-miR-4459	CLIP-seq
MIRT2005132	hsa-miR-4472	CLIP-seq
MIRT2005134	hsa-miR-4518	CLIP-seq
MIRT2005139	hsa-miR-4690-5p	CLIP-seq
MIRT2005140	hsa-miR-4701-5p	CLIP-seq
MIRT1028554	hsa-miR-4728-5p	CLIP-seq
MIRT2237792	hsa-miR-4731-5p	CLIP-seq
MIRT2005141	hsa-miR-4732-3p	CLIP-seq
MIRT2237793	hsa-miR-4739	CLIP-seq
MIRT2005143	hsa-miR-4752	CLIP-seq
MIRT2237794	hsa-miR-4756-5p	CLIP-seq
MIRT2237795	hsa-miR-4779	CLIP-seq
MIRT2237796	hsa-miR-486-3p	CLIP-seq
MIRT2237797	hsa-miR-510	CLIP-seq
MIRT2005147	hsa-miR-548s	CLIP-seq
MIRT2005149	hsa-miR-588	CLIP-seq
MIRT2005153	hsa-miR-761	CLIP-seq
MIRT2005154	hsa-miR-765	CLIP-seq
MIRT2005155	hsa-miR-874	CLIP-seq
MIRT2237798	hsa-miR-885-3p	CLIP-seq
MIRT2005104	hsa-miR-1291	CLIP-seq
MIRT2541829	hsa-miR-1915	CLIP-seq
MIRT2541830	hsa-miR-2355-5p	CLIP-seq
MIRT2005120	hsa-miR-3591-3p	CLIP-seq
MIRT2005125	hsa-miR-3918	CLIP-seq
MIRT2541831	hsa-miR-4685-5p	CLIP-seq
MIRT2005103	hsa-miR-1266	CLIP-seq
MIRT2005109	hsa-miR-214	CLIP-seq
MIRT2005122	hsa-miR-3619-5p	CLIP-seq
MIRT2681895	hsa-miR-3664-3p	CLIP-seq
MIRT2681896	hsa-miR-3907	CLIP-seq
MIRT2681897	hsa-miR-4291	CLIP-seq
MIRT2005134	hsa-miR-4518	CLIP-seq
MIRT2681898	hsa-miR-4519	CLIP-seq
MIRT2005151	hsa-miR-626	CLIP-seq
MIRT2005153	hsa-miR-761	CLIP-seq
MIRT1028563	hsa-miR-922	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005507	Function	Copper ion binding	IDA	12732622
GO:0005515	Function	Protein binding	IPI	30282023
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	2148568
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2148568
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IBA
GO:0014037	Process	Schwann cell differentiation	ISS
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0017134	Function	Fibroblast growth factor binding	IBA
GO:0017134	Function	Fibroblast growth factor binding	IEA
GO:0017134	Function	Fibroblast growth factor binding	ISS
GO:0030200	Process	Heparan sulfate proteoglycan catabolic process	IDA	12732622
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0032288	Process	Myelin assembly	ISS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IBA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	ISS
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043236	Function	Laminin binding	IEA
GO:0043236	Function	Laminin binding	ISS
GO:0045121	Component	Membrane raft	IDA	12732622
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0098552	Component	Side of membrane	IEA
GO:1905475	Process	Regulation of protein localization to membrane	IBA
GO:2001016	Process	Positive regulation of skeletal muscle cell differentiation	IEA
GO:2001016	Process	Positive regulation of skeletal muscle cell differentiation	ISS

MIM	HGNC	e!Ensembl
600395	4449	ENSG00000063660

P35052

Protein name

Glypican-1 [Cleaved into: Secreted glypican-1]

Protein function

Cell surface proteoglycan that bears heparan sulfate. Binds, via the heparan sulfate side chains, alpha-4 (V) collagen and participates in Schwann cell myelination (By similarity). May act as a catalyst in increasing the rate of conversion of pr

PDB

4ACR , 4AD7 , 4BWE , 4YWT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01153	Glypican	11 → 555	Glypican	Family

Sequence

MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLR
ICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSER
TLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP
QLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV
PLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLI
TDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR
RGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQD
ASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTF
LLPLLLFLALTVARPRWR

Sequence length

558

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLECYSTITIS, ACUTE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GPC1-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (91)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	29785020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29327712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29963198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	25046223		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17016645, 28232049, 28440066, 29245923, 29570265, 29721179, 30358133, 30800217, 31400579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	37585105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29672570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23336978, 27373597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	ORPHANET_DG	23336978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	30358741, 32315284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	30800217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	BEFREE	11920836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11454708, 28102194, 30202003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11454708, 16286510	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26657044, 32782317, 33742285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30800217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12000726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33902495, 36853298, 36944188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28440066, 30358133, 33302876, 35991837, 37470391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36159010	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36944188	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35850748	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CEREBRAL AMYLOID ANGIOPATHY, ITM2B-RELATED, 1	Cerebral Amyloid Angiopathy	BEFREE	16972883		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29055044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30358133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29254156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32744303, 35109912, 36158119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36944188	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28233416, 29254156, 30358133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33737938, 35671267, 36895014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23336978, 27373597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28426184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, familial Danish	Dementia	BEFREE	16972883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36944188	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27310703, 39300946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27310703, 28445969, 39300946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eyelid Xanthoma	Eyelid Xanthoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	17516498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30358133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28602885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28602885, 29322326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24019070, 33712571, 36944188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29322326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20360844, 36158119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30193893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33737938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18536657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30358133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11454708, 28102194, 30202003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10505759, 17016645, 24736782, 26106858, 28232049, 29721179, 29750031, 29963198, 30202003, 30425490, 30800217, 31414945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29672570, 29854284, 30202003, 30358133, 31391540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11454708, 23374155, 25046223, 26106858, 29055044, 29245923, 29854284, 31256115, 31355137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29254156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28102194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	29327712, 36944188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29785020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37775746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	LHGDN	11968010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10505759, 11454708, 24019070, 25046223, 26106858, 26482785, 26517809, 28445969, 29055044, 29721179, 29785020, 31391540, 31400579, 31414945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	16645004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	36944188	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15297422		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	31391540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10505759, 17016645, 24736782, 26106858, 28232049, 29721179, 29750031, 29963198, 30202003, 30425490, 30800217, 31414945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	26106858, 29162835, 29721179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	36159010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17016645, 28440066, 28539469, 29245923, 29721179, 30358133, 31400579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15249209, 17016645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	30425490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23270819, 24736782, 28232049, 31662449, 34565398, 36159010, 9802880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	28440066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28232049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	37585105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29672570, 29854284, 30202003, 30358133, 31391540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29672570, 33302918, 33947326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism, Type Ia	Pseudohypoparathyroidism	BEFREE	15521982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16052590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30664618		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	15084524		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	10814714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29055044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27310703, 28445969, 30730015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26657044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36944188	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	36944188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthoma	Xanthoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

GPC1 (glypican 1)