GP5 (glycoprotein V platelet)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2814
• Gene name: Glycoprotein V platelet
• Gene symbol: GP5
• Synonyms (NCBI Gene): CD42d, GPV
• Chromosome: 3
• Chromosome location: 3q29
• Summary: Human platelet glycoprotein V (GP5) is a part of the Ib-V-IX system of surface glycoproteins that constitute the receptor for von Willebrand factor (VWF; MIM 613160) and mediate the adhesion of platelets to injured vascular surfaces in the arterial circul

miRNA Show/Hide all (250)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052370	hsa-let-7a-5p	CLASH	23622248
MIRT691380	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT691379	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT691378	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT691377	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691376	hsa-miR-7112-5p	HITS-CLIP	23313552
MIRT485541	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691375	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691374	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691373	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691372	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691371	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691370	hsa-miR-7977	HITS-CLIP	23313552
MIRT691369	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691368	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691367	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691366	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691365	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691364	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691363	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691362	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691361	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691360	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691359	hsa-miR-7108-5p	HITS-CLIP	23313552
MIRT691358	hsa-miR-4474-3p	HITS-CLIP	23313552
MIRT691357	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691356	hsa-miR-3122	HITS-CLIP	23313552
MIRT691355	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691354	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691353	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT537113	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT537112	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT537111	hsa-miR-21-5p	PAR-CLIP	20371350
MIRT537110	hsa-miR-590-5p	PAR-CLIP	20371350
MIRT537109	hsa-miR-4539	PAR-CLIP	20371350
MIRT537107	hsa-miR-7158-3p	PAR-CLIP	20371350
MIRT537113	hsa-miR-382-3p	PAR-CLIP	22012620
MIRT537112	hsa-miR-708-3p	PAR-CLIP	22012620
MIRT537111	hsa-miR-21-5p	PAR-CLIP	22012620
MIRT537110	hsa-miR-590-5p	PAR-CLIP	22012620
MIRT537108	hsa-miR-4528	PAR-CLIP	22012620
MIRT537109	hsa-miR-4539	PAR-CLIP	22012620
MIRT537107	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT485554	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT485553	hsa-miR-4779	PAR-CLIP	23592263
MIRT485552	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT485551	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT485550	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT485549	hsa-miR-5739	PAR-CLIP	23592263
MIRT485547	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT485546	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT485545	hsa-miR-3153	PAR-CLIP	23592263
MIRT485544	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT485543	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT485541	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485542	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485540	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485539	hsa-miR-5698	PAR-CLIP	23592263
MIRT485538	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485537	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT485554	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT485553	hsa-miR-4779	PAR-CLIP	23592263
MIRT485552	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT485551	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT485550	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT485549	hsa-miR-5739	PAR-CLIP	23592263
MIRT485548	hsa-miR-765	PAR-CLIP	23592263
MIRT485547	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT485546	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT485545	hsa-miR-3153	PAR-CLIP	23592263
MIRT485544	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT485543	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT485541	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485542	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485540	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485539	hsa-miR-5698	PAR-CLIP	23592263
MIRT485538	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485537	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT691380	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT691379	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT691378	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT691377	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691376	hsa-miR-7112-5p	HITS-CLIP	23313552
MIRT485541	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691375	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691374	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691373	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691372	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691371	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691370	hsa-miR-7977	HITS-CLIP	23313552
MIRT691369	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691368	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691367	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691366	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691365	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691364	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691363	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691362	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691361	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691360	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691359	hsa-miR-7108-5p	HITS-CLIP	23313552
MIRT691358	hsa-miR-4474-3p	HITS-CLIP	23313552
MIRT691357	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691356	hsa-miR-3122	HITS-CLIP	23313552
MIRT691355	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691354	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691353	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT537113	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT537112	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT537111	hsa-miR-21-5p	PAR-CLIP	20371350
MIRT537110	hsa-miR-590-5p	PAR-CLIP	20371350
MIRT537109	hsa-miR-4539	PAR-CLIP	20371350
MIRT537107	hsa-miR-7158-3p	PAR-CLIP	20371350
MIRT537113	hsa-miR-382-3p	PAR-CLIP	22012620
MIRT537112	hsa-miR-708-3p	PAR-CLIP	22012620
MIRT537111	hsa-miR-21-5p	PAR-CLIP	22012620
MIRT537110	hsa-miR-590-5p	PAR-CLIP	22012620
MIRT537108	hsa-miR-4528	PAR-CLIP	22012620
MIRT537109	hsa-miR-4539	PAR-CLIP	22012620
MIRT537107	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT485554	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT485553	hsa-miR-4779	PAR-CLIP	23592263
MIRT485552	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT485551	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT485550	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT485549	hsa-miR-5739	PAR-CLIP	23592263
MIRT485547	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT485546	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT485545	hsa-miR-3153	PAR-CLIP	23592263
MIRT485544	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT485543	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT485541	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485542	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485540	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485539	hsa-miR-5698	PAR-CLIP	23592263
MIRT485538	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485537	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT485554	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT485553	hsa-miR-4779	PAR-CLIP	23592263
MIRT485552	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT485551	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT485550	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT485549	hsa-miR-5739	PAR-CLIP	23592263
MIRT485548	hsa-miR-765	PAR-CLIP	23592263
MIRT485547	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT485546	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT485545	hsa-miR-3153	PAR-CLIP	23592263
MIRT485544	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT485543	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT485541	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485542	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485540	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485539	hsa-miR-5698	PAR-CLIP	23592263
MIRT485538	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485537	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT1027965	hsa-miR-1253	CLIP-seq
MIRT1027966	hsa-miR-145	CLIP-seq
MIRT1027967	hsa-miR-1827	CLIP-seq
MIRT1027968	hsa-miR-183	CLIP-seq
MIRT1027969	hsa-miR-1972	CLIP-seq
MIRT1027970	hsa-miR-2277-3p	CLIP-seq
MIRT1027971	hsa-miR-3125	CLIP-seq
MIRT1027972	hsa-miR-3157-5p	CLIP-seq
MIRT1027973	hsa-miR-3185	CLIP-seq
MIRT1027974	hsa-miR-3192	CLIP-seq
MIRT1027975	hsa-miR-3194-5p	CLIP-seq
MIRT1027976	hsa-miR-34b	CLIP-seq
MIRT1027977	hsa-miR-3529	CLIP-seq
MIRT1027978	hsa-miR-379	CLIP-seq
MIRT1027979	hsa-miR-3916	CLIP-seq
MIRT1027980	hsa-miR-4269	CLIP-seq
MIRT1027981	hsa-miR-433	CLIP-seq
MIRT1027982	hsa-miR-4433	CLIP-seq
MIRT1027983	hsa-miR-4435	CLIP-seq
MIRT1027984	hsa-miR-4451	CLIP-seq
MIRT1027985	hsa-miR-4470	CLIP-seq
MIRT1027986	hsa-miR-4487	CLIP-seq
MIRT1027987	hsa-miR-4504	CLIP-seq
MIRT1027988	hsa-miR-4536	CLIP-seq
MIRT1027989	hsa-miR-4640-5p	CLIP-seq
MIRT1027990	hsa-miR-4650-3p	CLIP-seq
MIRT1027991	hsa-miR-4691-3p	CLIP-seq
MIRT1027992	hsa-miR-4704-3p	CLIP-seq
MIRT1027993	hsa-miR-4717-3p	CLIP-seq
MIRT1027994	hsa-miR-4726-5p	CLIP-seq
MIRT1027995	hsa-miR-4732-5p	CLIP-seq
MIRT1027996	hsa-miR-4755-3p	CLIP-seq
MIRT1027997	hsa-miR-490-3p	CLIP-seq
MIRT1027998	hsa-miR-542-3p	CLIP-seq
MIRT1027999	hsa-miR-580	CLIP-seq
MIRT1028000	hsa-miR-646	CLIP-seq
MIRT1028001	hsa-miR-661	CLIP-seq
MIRT1028002	hsa-miR-663b	CLIP-seq
MIRT1028003	hsa-miR-664	CLIP-seq
MIRT1028004	hsa-miR-665	CLIP-seq
MIRT2004936	hsa-miR-106a	CLIP-seq
MIRT2004937	hsa-miR-106b	CLIP-seq
MIRT2004938	hsa-miR-139-3p	CLIP-seq
MIRT2004939	hsa-miR-142-5p	CLIP-seq
MIRT2004940	hsa-miR-17	CLIP-seq
MIRT2004941	hsa-miR-20a	CLIP-seq
MIRT2004942	hsa-miR-20b	CLIP-seq
MIRT2004943	hsa-miR-3545-3p	CLIP-seq
MIRT2004944	hsa-miR-3609	CLIP-seq
MIRT2004945	hsa-miR-3919	CLIP-seq
MIRT2004946	hsa-miR-4329	CLIP-seq
MIRT2004947	hsa-miR-4496	CLIP-seq
MIRT2004948	hsa-miR-4707-5p	CLIP-seq
MIRT2004949	hsa-miR-4756-3p	CLIP-seq
MIRT2004950	hsa-miR-4796-3p	CLIP-seq
MIRT2004951	hsa-miR-519d	CLIP-seq
MIRT2004952	hsa-miR-539	CLIP-seq
MIRT2004953	hsa-miR-548ah	CLIP-seq
MIRT2004954	hsa-miR-873	CLIP-seq
MIRT2004955	hsa-miR-93	CLIP-seq
MIRT2004938	hsa-miR-139-3p	CLIP-seq
MIRT2004943	hsa-miR-3545-3p	CLIP-seq
MIRT2237636	hsa-miR-4261	CLIP-seq
MIRT1027980	hsa-miR-4269	CLIP-seq
MIRT2004946	hsa-miR-4329	CLIP-seq
MIRT2237637	hsa-miR-4645-5p	CLIP-seq
MIRT2237638	hsa-miR-4673	CLIP-seq
MIRT1027996	hsa-miR-4755-3p	CLIP-seq
MIRT2388590	hsa-miR-4709-3p	CLIP-seq
MIRT1027967	hsa-miR-1827	CLIP-seq
MIRT1027974	hsa-miR-3192	CLIP-seq
MIRT1027976	hsa-miR-34b	CLIP-seq
MIRT2450525	hsa-miR-3672	CLIP-seq
MIRT1027997	hsa-miR-490-3p	CLIP-seq
MIRT1027999	hsa-miR-580	CLIP-seq
MIRT2450526	hsa-miR-7	CLIP-seq
MIRT1027967	hsa-miR-1827	CLIP-seq
MIRT1027974	hsa-miR-3192	CLIP-seq
MIRT1027976	hsa-miR-34b	CLIP-seq
MIRT2541629	hsa-miR-4477b	CLIP-seq
MIRT2004947	hsa-miR-4496	CLIP-seq
MIRT1027997	hsa-miR-490-3p	CLIP-seq
MIRT1027999	hsa-miR-580	CLIP-seq
MIRT2541630	hsa-miR-658	CLIP-seq
MIRT1028002	hsa-miR-663b	CLIP-seq
MIRT2004954	hsa-miR-873	CLIP-seq
MIRT1027967	hsa-miR-1827	CLIP-seq
MIRT1027974	hsa-miR-3192	CLIP-seq
MIRT1027976	hsa-miR-34b	CLIP-seq
MIRT2541629	hsa-miR-4477b	CLIP-seq
MIRT2004947	hsa-miR-4496	CLIP-seq
MIRT1027997	hsa-miR-490-3p	CLIP-seq
MIRT1027999	hsa-miR-580	CLIP-seq
MIRT1028002	hsa-miR-663b	CLIP-seq
MIRT2004954	hsa-miR-873	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	1730602
GO:0005886	Component	Plasma membrane	TAS	7690959, 10429193
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	7690959
GO:0007596	Process	Blood coagulation	IBA
GO:0007596	Process	Blood coagulation	IEA
GO:0007597	Process	Blood coagulation, intrinsic pathway	IPI	10501658
GO:0007597	Process	Blood coagulation, intrinsic pathway	NAS	16293600
GO:0007599	Process	Hemostasis	IEA
GO:0010572	Process	Positive regulation of platelet activation	IDA	1939645
GO:0010572	Process	Positive regulation of platelet activation	NAS	16293600
GO:0016020	Component	Membrane	IEA
GO:0035855	Process	Megakaryocyte development	ISO
GO:0035855	Process	Megakaryocyte development	NAS	16293600
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	1939645
GO:0051209	Process	Release of sequestered calcium ion into cytosol	NAS	16293600
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1990779	Component	Glycoprotein Ib-IX-V complex	IPI	1730602
GO:1990779	Component	Glycoprotein Ib-IX-V complex	NAS	16293600

Other IDs

• MIM: 173511
• HGNC: 4443
• e!Ensembl: ENSG00000178732

Protein

• UniProt ID: P40197
• Protein name: Platelet glycoprotein V (GPV) (Glycoprotein 5) (CD antigen CD42d)
• Protein function: The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	74 → 134	Leucine rich repeat	Repeat
  PF13855	LRR_8	194 → 254	Leucine rich repeat	Repeat
  PF13855	LRR_8	98 → 158	Leucine rich repeat	Repeat
  PF13855	LRR_8	364 → 422	Leucine rich repeat	Repeat
  PF13855	LRR_8	124 → 182	Leucine rich repeat	Repeat
  PF13855	LRR_8	146 → 192	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Platelets and megakaryocytes.
• Sequence:

  MLRGTLLCAVLGLLRAQPFPCPPACKCVFRDAAQCSGGDVARISALGLPTNLTHILLFGM
  GRGVLQSQSFSGMTVLQRLMISDSHISAVAPGTFSDLIKLKTLRLSRNKITHLPGALLDK
  MVLLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGN
  NLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDR
  LPNLSSLTLSRNHLAFLPSALFLHSHNLTLLTLFENPLAELPGVLFGEMGGLQELWLNRT
  QLRTLPAAAFRNLSRLRYLGVTLSPRLSALPQGAFQGLGELQVLALHSNGLTALPDGLLR
  GLGKLRQVSLRRNRLRALPRALFRNLSSLESVQLDHNQLETLPGDVFGALPRLTEVLLGH
  NSWRCDCGLGPFLGWLRQHLGLVGGEEPPRCAGPGAHAGLPLWALPGGDAECPGPRGPPP
  RPAADSSSEAPVHPALAPNSSEPWVWAQPVTTGKGQDHSPFWGFYFLLLAVQAMITVIIV
  FAMIKIGQLFRKLIRERALG

• Sequence length: 560

Pathways

KEGG Pathway	Reactome Pathway
ECM-receptor interaction	Intrinsic Pathway of Fibrin Clot Formation
Platelet activation	GP1b-IX-V activation signalling
Hematopoietic cell lineage	Platelet Adhesion to exposed collagen
	Platelet Aggregation (Plug Formation)

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GP1BB 7 shared pathwaysECM-receptor interaction, Platelet activation, Hematopoietic cell lineage, GP1b-IX-V activation signalling, Platelet Adhesion to exposed collagen, Platelet Aggregation (Plug Formation), Intrinsic Pathway of Fibrin Clot Formation Related via 7 shared pathways including ECM-receptor interaction, Platelet activation. GP9 7 shared pathwaysECM-receptor interaction, Platelet activation, Hematopoietic cell lineage, GP1b-IX-V activation signalling, Platelet Adhesion to exposed collagen, Platelet Aggregation (Plug Formation), Intrinsic Pathway of Fibrin Clot Formation Related via 7 shared pathways including ECM-receptor interaction, Platelet activation. GP1BA 7 shared pathwaysECM-receptor interaction, Platelet activation, Hematopoietic cell lineage, GP1b-IX-V activation signalling, Platelet Adhesion to exposed collagen, Platelet Aggregation (Plug Formation), Intrinsic Pathway of Fibrin Clot Formation Related via 7 shared pathways including ECM-receptor interaction, Platelet activation. GP6 3 shared pathwaysECM-receptor interaction, Platelet activation, Platelet Adhesion to exposed collagen Related via 3 shared pathways including ECM-receptor interaction, Platelet activation. VWF 6 shared pathwaysECM-receptor interaction, Platelet activation, GP1b-IX-V activation signalling, Platelet Adhesion to exposed collagen, Platelet Aggregation (Plug Formation), Intrinsic Pathway of Fibrin Clot Formation Related via 6 shared pathways including ECM-receptor interaction, Platelet activation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GP1BB	0	[]	7	["ECM-receptor interaction","Platelet activation","Hematopoietic cell lineage","GP1b-IX-V activation signalling","Platelet Adhesion to exposed collagen","Platelet Aggregation (Plug Formation)","Intrinsic Pathway of Fibrin Clot Formation"]	0	[]
GP9	0	[]	7	["ECM-receptor interaction","Platelet activation","Hematopoietic cell lineage","GP1b-IX-V activation signalling","Platelet Adhesion to exposed collagen","Platelet Aggregation (Plug Formation)","Intrinsic Pathway of Fibrin Clot Formation"]	0	[]
GP1BA	0	[]	7	["ECM-receptor interaction","Platelet activation","Hematopoietic cell lineage","GP1b-IX-V activation signalling","Platelet Adhesion to exposed collagen","Platelet Aggregation (Plug Formation)","Intrinsic Pathway of Fibrin Clot Formation"]	0	[]
GP6	0	[]	3	["ECM-receptor interaction","Platelet activation","Platelet Adhesion to exposed collagen"]	0	[]
VWF	0	[]	6	["ECM-receptor interaction","Platelet activation","GP1b-IX-V activation signalling","Platelet Adhesion to exposed collagen","Platelet Aggregation (Plug Formation)","Intrinsic Pathway of Fibrin Clot Formation"]	0	[]

Diseases Linked via Similar Genes

Thrombocytopenia Linked via 5 of 5 related genesGP1BB, GP9, GP1BA, GP6, VWF Bernard-soulier syndrome Linked via 4 of 5 related genesGP1BB, GP9, GP1BA, VWF Von willebrand disorder Linked via 3 of 5 related genesGP1BA, GP6, VWF Macrothrombocytopenia Linked via 2 of 5 related genesGP1BB, GP1BA Hypertension Linked via 2 of 5 related genesGP1BA, VWF

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Thrombocytopenia	5	["GP1BB","GP9","GP1BA","GP6","VWF"]
Bernard-soulier syndrome	4	["GP1BB","GP9","GP1BA","VWF"]
Von willebrand disorder	3	["GP1BA","GP6","VWF"]
Macrothrombocytopenia	2	["GP1BB","GP1BA"]
Hypertension	2	["GP1BA","VWF"]