GORASP1 (golgi reassembly stacking protein 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 64689
• Gene name: Golgi reassembly stacking protein 1
• Gene symbol: GORASP1
• Synonyms (NCBI Gene): GOLPH5, GRASP65, P65
• Chromosome: 3
• Chromosome location: 3p22.2
• Summary: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a c

miRNA Show/Hide all (337)

miRTarBase ID	miRNA	Experiments	Reference
MIRT639574	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT639573	hsa-miR-4773	HITS-CLIP	23824327
MIRT639572	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT639571	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT639570	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT639569	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639568	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639567	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT639574	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT639573	hsa-miR-4773	HITS-CLIP	23824327
MIRT639572	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT639571	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT639570	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT639569	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639568	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639567	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT1027434	hsa-miR-1302	CLIP-seq
MIRT1027435	hsa-miR-141	CLIP-seq
MIRT1027436	hsa-miR-1972	CLIP-seq
MIRT1027437	hsa-miR-200a	CLIP-seq
MIRT1027438	hsa-miR-3120-3p	CLIP-seq
MIRT1027439	hsa-miR-3122	CLIP-seq
MIRT1027440	hsa-miR-3649	CLIP-seq
MIRT1027441	hsa-miR-3654	CLIP-seq
MIRT1027442	hsa-miR-3913-5p	CLIP-seq
MIRT1027443	hsa-miR-3919	CLIP-seq
MIRT1027444	hsa-miR-4298	CLIP-seq
MIRT1027445	hsa-miR-4469	CLIP-seq
MIRT1027446	hsa-miR-4520a-3p	CLIP-seq
MIRT1027447	hsa-miR-4638-3p	CLIP-seq
MIRT1027448	hsa-miR-4639-5p	CLIP-seq
MIRT1027449	hsa-miR-4670-5p	CLIP-seq
MIRT1027450	hsa-miR-4735-5p	CLIP-seq
MIRT1027451	hsa-miR-4797-5p	CLIP-seq
MIRT2004752	hsa-miR-103b	CLIP-seq
MIRT2004753	hsa-miR-1179	CLIP-seq
MIRT2004754	hsa-miR-1197	CLIP-seq
MIRT2004755	hsa-miR-1208	CLIP-seq
MIRT2004756	hsa-miR-1224-3p	CLIP-seq
MIRT2004757	hsa-miR-1226	CLIP-seq
MIRT2004758	hsa-miR-125a-3p	CLIP-seq
MIRT2004759	hsa-miR-1260	CLIP-seq
MIRT2004760	hsa-miR-1260b	CLIP-seq
MIRT2004761	hsa-miR-1280	CLIP-seq
MIRT2004762	hsa-miR-1292	CLIP-seq
MIRT1027434	hsa-miR-1302	CLIP-seq
MIRT2004763	hsa-miR-1321	CLIP-seq
MIRT2004764	hsa-miR-15a	CLIP-seq
MIRT2004765	hsa-miR-15b	CLIP-seq
MIRT2004766	hsa-miR-16	CLIP-seq
MIRT2004767	hsa-miR-1914	CLIP-seq
MIRT2004768	hsa-miR-195	CLIP-seq
MIRT2004769	hsa-miR-2467-3p	CLIP-seq
MIRT2004770	hsa-miR-3117-5p	CLIP-seq
MIRT1027439	hsa-miR-3122	CLIP-seq
MIRT2004771	hsa-miR-3135	CLIP-seq
MIRT2004772	hsa-miR-3184	CLIP-seq
MIRT2004773	hsa-miR-330-3p	CLIP-seq
MIRT2004774	hsa-miR-338-3p	CLIP-seq
MIRT2004775	hsa-miR-376a	CLIP-seq
MIRT2004776	hsa-miR-376b	CLIP-seq
MIRT2004777	hsa-miR-378g	CLIP-seq
MIRT1027442	hsa-miR-3913-5p	CLIP-seq
MIRT2004778	hsa-miR-3934	CLIP-seq
MIRT2004779	hsa-miR-423-5p	CLIP-seq
MIRT2004780	hsa-miR-424	CLIP-seq
MIRT2004781	hsa-miR-4280	CLIP-seq
MIRT1027444	hsa-miR-4298	CLIP-seq
MIRT2004782	hsa-miR-4302	CLIP-seq
MIRT2004783	hsa-miR-4310	CLIP-seq
MIRT2004784	hsa-miR-4436a	CLIP-seq
MIRT2004785	hsa-miR-4437	CLIP-seq
MIRT2004786	hsa-miR-4471	CLIP-seq
MIRT2004787	hsa-miR-4643	CLIP-seq
MIRT2004788	hsa-miR-4674	CLIP-seq
MIRT2004789	hsa-miR-4728-5p	CLIP-seq
MIRT2004790	hsa-miR-4739	CLIP-seq
MIRT2004791	hsa-miR-4756-5p	CLIP-seq
MIRT1027451	hsa-miR-4797-5p	CLIP-seq
MIRT2004792	hsa-miR-497	CLIP-seq
MIRT2004793	hsa-miR-505	CLIP-seq
MIRT2004794	hsa-miR-520d-5p	CLIP-seq
MIRT2004795	hsa-miR-524-5p	CLIP-seq
MIRT2004796	hsa-miR-552	CLIP-seq
MIRT2004797	hsa-miR-634	CLIP-seq
MIRT2004798	hsa-miR-642b	CLIP-seq
MIRT2004799	hsa-miR-665	CLIP-seq
MIRT2004800	hsa-miR-670	CLIP-seq
MIRT2004801	hsa-miR-764	CLIP-seq
MIRT2004802	hsa-miR-922	CLIP-seq
MIRT2004753	hsa-miR-1179	CLIP-seq
MIRT2004754	hsa-miR-1197	CLIP-seq
MIRT2004755	hsa-miR-1208	CLIP-seq
MIRT2004757	hsa-miR-1226	CLIP-seq
MIRT2237513	hsa-miR-1243	CLIP-seq
MIRT2004758	hsa-miR-125a-3p	CLIP-seq
MIRT2237514	hsa-miR-1262	CLIP-seq
MIRT2237515	hsa-miR-134	CLIP-seq
MIRT2237516	hsa-miR-1470	CLIP-seq
MIRT2004767	hsa-miR-1914	CLIP-seq
MIRT2237517	hsa-miR-2355-5p	CLIP-seq
MIRT2004769	hsa-miR-2467-3p	CLIP-seq
MIRT2237518	hsa-miR-3118	CLIP-seq
MIRT2237519	hsa-miR-3164	CLIP-seq
MIRT2004772	hsa-miR-3184	CLIP-seq
MIRT2004774	hsa-miR-338-3p	CLIP-seq
MIRT2237520	hsa-miR-3616-3p	CLIP-seq
MIRT1027441	hsa-miR-3654	CLIP-seq
MIRT2237521	hsa-miR-377	CLIP-seq
MIRT2004778	hsa-miR-3934	CLIP-seq
MIRT2237522	hsa-miR-412	CLIP-seq
MIRT2004779	hsa-miR-423-5p	CLIP-seq
MIRT2004783	hsa-miR-4310	CLIP-seq
MIRT2237523	hsa-miR-4433	CLIP-seq
MIRT2004784	hsa-miR-4436a	CLIP-seq
MIRT1027445	hsa-miR-4469	CLIP-seq
MIRT2237524	hsa-miR-4494	CLIP-seq
MIRT2237525	hsa-miR-4535	CLIP-seq
MIRT2237526	hsa-miR-4667-3p	CLIP-seq
MIRT2237527	hsa-miR-4701-3p	CLIP-seq
MIRT2237528	hsa-miR-4710	CLIP-seq
MIRT2237529	hsa-miR-4721	CLIP-seq
MIRT2237530	hsa-miR-4755-3p	CLIP-seq
MIRT1027451	hsa-miR-4797-5p	CLIP-seq
MIRT2237531	hsa-miR-491-3p	CLIP-seq
MIRT2237532	hsa-miR-492	CLIP-seq
MIRT2237533	hsa-miR-499a-5p	CLIP-seq
MIRT2237534	hsa-miR-501-3p	CLIP-seq
MIRT2237535	hsa-miR-502-3p	CLIP-seq
MIRT2004794	hsa-miR-520d-5p	CLIP-seq
MIRT2004795	hsa-miR-524-5p	CLIP-seq
MIRT2237536	hsa-miR-544b	CLIP-seq
MIRT2237537	hsa-miR-548v	CLIP-seq
MIRT2004797	hsa-miR-634	CLIP-seq
MIRT2004798	hsa-miR-642b	CLIP-seq
MIRT2237538	hsa-miR-660	CLIP-seq
MIRT2004799	hsa-miR-665	CLIP-seq
MIRT2004800	hsa-miR-670	CLIP-seq
MIRT2004801	hsa-miR-764	CLIP-seq
MIRT2237539	hsa-miR-891b	CLIP-seq
MIRT2004802	hsa-miR-922	CLIP-seq
MIRT2004774	hsa-miR-338-3p	CLIP-seq
MIRT2004754	hsa-miR-1197	CLIP-seq
MIRT2541370	hsa-miR-1207-3p	CLIP-seq
MIRT2004755	hsa-miR-1208	CLIP-seq
MIRT2004756	hsa-miR-1224-3p	CLIP-seq
MIRT2004757	hsa-miR-1226	CLIP-seq
MIRT2541371	hsa-miR-125a-5p	CLIP-seq
MIRT2541372	hsa-miR-125b	CLIP-seq
MIRT2004759	hsa-miR-1260	CLIP-seq
MIRT2004760	hsa-miR-1260b	CLIP-seq
MIRT2004761	hsa-miR-1280	CLIP-seq
MIRT2541373	hsa-miR-1285	CLIP-seq
MIRT1027434	hsa-miR-1302	CLIP-seq
MIRT2541374	hsa-miR-1305	CLIP-seq
MIRT2541375	hsa-miR-130a	CLIP-seq
MIRT2541376	hsa-miR-130b	CLIP-seq
MIRT2541377	hsa-miR-132	CLIP-seq
MIRT2237516	hsa-miR-1470	CLIP-seq
MIRT2004764	hsa-miR-15a	CLIP-seq
MIRT2004765	hsa-miR-15b	CLIP-seq
MIRT2004766	hsa-miR-16	CLIP-seq
MIRT2541378	hsa-miR-1910	CLIP-seq
MIRT2004767	hsa-miR-1914	CLIP-seq
MIRT2004768	hsa-miR-195	CLIP-seq
MIRT2541379	hsa-miR-203	CLIP-seq
MIRT2541380	hsa-miR-2114	CLIP-seq
MIRT2541381	hsa-miR-212	CLIP-seq
MIRT2541382	hsa-miR-2278	CLIP-seq
MIRT2541383	hsa-miR-2861	CLIP-seq
MIRT2541384	hsa-miR-301a	CLIP-seq
MIRT2541385	hsa-miR-301b	CLIP-seq
MIRT2004770	hsa-miR-3117-5p	CLIP-seq
MIRT1027439	hsa-miR-3122	CLIP-seq
MIRT2541386	hsa-miR-3179	CLIP-seq
MIRT2541387	hsa-miR-3185	CLIP-seq
MIRT2541388	hsa-miR-3187-5p	CLIP-seq
MIRT2541389	hsa-miR-3194-3p	CLIP-seq
MIRT2541390	hsa-miR-320e	CLIP-seq
MIRT2004773	hsa-miR-330-3p	CLIP-seq
MIRT2004774	hsa-miR-338-3p	CLIP-seq
MIRT2541391	hsa-miR-3607-3p	CLIP-seq
MIRT2541392	hsa-miR-3622a-5p	CLIP-seq
MIRT2541393	hsa-miR-3622b-5p	CLIP-seq
MIRT2541394	hsa-miR-3646	CLIP-seq
MIRT1027440	hsa-miR-3649	CLIP-seq
MIRT2541395	hsa-miR-3666	CLIP-seq
MIRT2541396	hsa-miR-3672	CLIP-seq
MIRT2541397	hsa-miR-3688-5p	CLIP-seq
MIRT2004775	hsa-miR-376a	CLIP-seq
MIRT2004776	hsa-miR-376b	CLIP-seq
MIRT2004777	hsa-miR-378g	CLIP-seq
MIRT1027442	hsa-miR-3913-5p	CLIP-seq
MIRT2541398	hsa-miR-3915	CLIP-seq
MIRT2541399	hsa-miR-3928	CLIP-seq
MIRT2541400	hsa-miR-3940-3p	CLIP-seq
MIRT2541401	hsa-miR-3944-5p	CLIP-seq
MIRT2004780	hsa-miR-424	CLIP-seq
MIRT2541402	hsa-miR-4252	CLIP-seq
MIRT2541403	hsa-miR-4295	CLIP-seq
MIRT1027444	hsa-miR-4298	CLIP-seq
MIRT2004783	hsa-miR-4310	CLIP-seq
MIRT2541404	hsa-miR-4319	CLIP-seq
MIRT2541405	hsa-miR-4423-3p	CLIP-seq
MIRT2541406	hsa-miR-4424	CLIP-seq
MIRT2004784	hsa-miR-4436a	CLIP-seq
MIRT2004785	hsa-miR-4437	CLIP-seq
MIRT2541407	hsa-miR-4450	CLIP-seq
MIRT1027445	hsa-miR-4469	CLIP-seq
MIRT2541408	hsa-miR-4475	CLIP-seq
MIRT2541409	hsa-miR-4486	CLIP-seq
MIRT2541410	hsa-miR-4490	CLIP-seq
MIRT2541411	hsa-miR-4527	CLIP-seq
MIRT2541412	hsa-miR-454	CLIP-seq
MIRT1027448	hsa-miR-4639-5p	CLIP-seq
MIRT2541413	hsa-miR-4652-3p	CLIP-seq
MIRT2237526	hsa-miR-4667-3p	CLIP-seq
MIRT2541414	hsa-miR-4667-5p	CLIP-seq
MIRT2541415	hsa-miR-4671-3p	CLIP-seq
MIRT2004788	hsa-miR-4674	CLIP-seq
MIRT2541416	hsa-miR-4700-5p	CLIP-seq
MIRT2541417	hsa-miR-4719	CLIP-seq
MIRT2541418	hsa-miR-4732-3p	CLIP-seq
MIRT1027450	hsa-miR-4735-5p	CLIP-seq
MIRT2237530	hsa-miR-4755-3p	CLIP-seq
MIRT2541419	hsa-miR-4763-5p	CLIP-seq
MIRT2541420	hsa-miR-4774-5p	CLIP-seq
MIRT2541421	hsa-miR-4778-5p	CLIP-seq
MIRT1027451	hsa-miR-4797-5p	CLIP-seq
MIRT2541422	hsa-miR-486-5p	CLIP-seq
MIRT2237531	hsa-miR-491-3p	CLIP-seq
MIRT2004792	hsa-miR-497	CLIP-seq
MIRT2237534	hsa-miR-501-3p	CLIP-seq
MIRT2237535	hsa-miR-502-3p	CLIP-seq
MIRT2004794	hsa-miR-520d-5p	CLIP-seq
MIRT2004795	hsa-miR-524-5p	CLIP-seq
MIRT2237536	hsa-miR-544b	CLIP-seq
MIRT2541423	hsa-miR-548m	CLIP-seq
MIRT2237537	hsa-miR-548v	CLIP-seq
MIRT2004796	hsa-miR-552	CLIP-seq
MIRT2541424	hsa-miR-612	CLIP-seq
MIRT2004797	hsa-miR-634	CLIP-seq
MIRT2004798	hsa-miR-642b	CLIP-seq
MIRT2541425	hsa-miR-646	CLIP-seq
MIRT2004799	hsa-miR-665	CLIP-seq
MIRT2004800	hsa-miR-670	CLIP-seq
MIRT2004754	hsa-miR-1197	CLIP-seq
MIRT2541370	hsa-miR-1207-3p	CLIP-seq
MIRT2004755	hsa-miR-1208	CLIP-seq
MIRT2004756	hsa-miR-1224-3p	CLIP-seq
MIRT2004757	hsa-miR-1226	CLIP-seq
MIRT2541371	hsa-miR-125a-5p	CLIP-seq
MIRT2541372	hsa-miR-125b	CLIP-seq
MIRT2004759	hsa-miR-1260	CLIP-seq
MIRT2004760	hsa-miR-1260b	CLIP-seq
MIRT2004761	hsa-miR-1280	CLIP-seq
MIRT2004762	hsa-miR-1292	CLIP-seq
MIRT1027434	hsa-miR-1302	CLIP-seq
MIRT2541374	hsa-miR-1305	CLIP-seq
MIRT2541377	hsa-miR-132	CLIP-seq
MIRT2004764	hsa-miR-15a	CLIP-seq
MIRT2004765	hsa-miR-15b	CLIP-seq
MIRT2004766	hsa-miR-16	CLIP-seq
MIRT2541378	hsa-miR-1910	CLIP-seq
MIRT2004767	hsa-miR-1914	CLIP-seq
MIRT2004768	hsa-miR-195	CLIP-seq
MIRT2541380	hsa-miR-2114	CLIP-seq
MIRT2541381	hsa-miR-212	CLIP-seq
MIRT2541382	hsa-miR-2278	CLIP-seq
MIRT2004770	hsa-miR-3117-5p	CLIP-seq
MIRT1027439	hsa-miR-3122	CLIP-seq
MIRT2541386	hsa-miR-3179	CLIP-seq
MIRT2541387	hsa-miR-3185	CLIP-seq
MIRT2541389	hsa-miR-3194-3p	CLIP-seq
MIRT2541390	hsa-miR-320e	CLIP-seq
MIRT2004773	hsa-miR-330-3p	CLIP-seq
MIRT2004774	hsa-miR-338-3p	CLIP-seq
MIRT2541391	hsa-miR-3607-3p	CLIP-seq
MIRT2541392	hsa-miR-3622a-5p	CLIP-seq
MIRT2541393	hsa-miR-3622b-5p	CLIP-seq
MIRT2541394	hsa-miR-3646	CLIP-seq
MIRT1027440	hsa-miR-3649	CLIP-seq
MIRT2541396	hsa-miR-3672	CLIP-seq
MIRT2541397	hsa-miR-3688-5p	CLIP-seq
MIRT2004775	hsa-miR-376a	CLIP-seq
MIRT2004776	hsa-miR-376b	CLIP-seq
MIRT2004777	hsa-miR-378g	CLIP-seq
MIRT1027442	hsa-miR-3913-5p	CLIP-seq
MIRT2541398	hsa-miR-3915	CLIP-seq
MIRT2541399	hsa-miR-3928	CLIP-seq
MIRT2004780	hsa-miR-424	CLIP-seq
MIRT2541402	hsa-miR-4252	CLIP-seq
MIRT2681784	hsa-miR-4274	CLIP-seq
MIRT1027444	hsa-miR-4298	CLIP-seq
MIRT2004782	hsa-miR-4302	CLIP-seq
MIRT2004783	hsa-miR-4310	CLIP-seq
MIRT2541404	hsa-miR-4319	CLIP-seq
MIRT2541405	hsa-miR-4423-3p	CLIP-seq
MIRT2541406	hsa-miR-4424	CLIP-seq
MIRT2004784	hsa-miR-4436a	CLIP-seq
MIRT2004785	hsa-miR-4437	CLIP-seq
MIRT2541407	hsa-miR-4450	CLIP-seq
MIRT2004786	hsa-miR-4471	CLIP-seq
MIRT2541408	hsa-miR-4475	CLIP-seq
MIRT2541410	hsa-miR-4490	CLIP-seq
MIRT2681785	hsa-miR-4519	CLIP-seq
MIRT2681786	hsa-miR-4524	CLIP-seq
MIRT1027448	hsa-miR-4639-5p	CLIP-seq
MIRT2681787	hsa-miR-4648	CLIP-seq
MIRT2541413	hsa-miR-4652-3p	CLIP-seq
MIRT2681788	hsa-miR-4654	CLIP-seq
MIRT2541414	hsa-miR-4667-5p	CLIP-seq
MIRT2004788	hsa-miR-4674	CLIP-seq
MIRT2541416	hsa-miR-4700-5p	CLIP-seq
MIRT2541418	hsa-miR-4732-3p	CLIP-seq
MIRT1027450	hsa-miR-4735-5p	CLIP-seq
MIRT2237530	hsa-miR-4755-3p	CLIP-seq
MIRT2681789	hsa-miR-4769-5p	CLIP-seq
MIRT2541420	hsa-miR-4774-5p	CLIP-seq
MIRT2541421	hsa-miR-4778-5p	CLIP-seq
MIRT1027451	hsa-miR-4797-5p	CLIP-seq
MIRT2541422	hsa-miR-486-5p	CLIP-seq
MIRT2237531	hsa-miR-491-3p	CLIP-seq
MIRT2004792	hsa-miR-497	CLIP-seq
MIRT2237534	hsa-miR-501-3p	CLIP-seq
MIRT2237535	hsa-miR-502-3p	CLIP-seq
MIRT2004794	hsa-miR-520d-5p	CLIP-seq
MIRT2004795	hsa-miR-524-5p	CLIP-seq
MIRT2237536	hsa-miR-544b	CLIP-seq
MIRT2541423	hsa-miR-548m	CLIP-seq
MIRT2237537	hsa-miR-548v	CLIP-seq
MIRT2004796	hsa-miR-552	CLIP-seq
MIRT2004797	hsa-miR-634	CLIP-seq
MIRT2004798	hsa-miR-642b	CLIP-seq
MIRT2541425	hsa-miR-646	CLIP-seq
MIRT2004799	hsa-miR-665	CLIP-seq
MIRT2004800	hsa-miR-670	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005515	Function	Protein binding	IPI	16489344, 18045989, 25416956, 26871637, 31515488, 32296183, 32353859, 33060197, 36217030
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	18045989
GO:0005794	Component	Golgi apparatus	IEA
GO:0005801	Component	Cis-Golgi network	NAS	26363069
GO:0006487	Process	Protein N-linked glycosylation	IEA
GO:0007030	Process	Golgi organization	IBA
GO:0007030	Process	Golgi organization	IEA
GO:0007030	Process	Golgi organization	ISS
GO:0007030	Process	Golgi organization	NAS	26363069
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050774	Process	Negative regulation of dendrite morphogenesis	IMP	21572988
GO:0061951	Process	Establishment of protein localization to plasma membrane	IEA
GO:0061951	Process	Establishment of protein localization to plasma membrane	IMP	21884936
GO:0090161	Process	Golgi ribbon formation	IEA
GO:0090161	Process	Golgi ribbon formation	IGI	33301566

Other IDs

• MIM: 606867
• HGNC: 16769
• e!Ensembl: ENSG00000114745

Protein

• UniProt ID: Q9BQQ3
• Protein name: Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi phosphoprotein 5) (GOLPH5) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65)
• Protein function: Key structural protein of the Golgi apparatus (PubMed:33301566). The membrane cisternae of the Golgi apparatus adhere to each other to form stacks, which are aligned side by side to form the Golgi ribbon (PubMed:33301566). Acting in concert with
• PDB: 4REY , 6G8T , 6G8W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04495	GRASP55_65	69 → 205	GRASP55/65 PDZ-like domain	Domain
  PF04495	GRASP55_65	1 → 91	GRASP55/65 PDZ-like domain	Domain

• Sequence:

  MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLK
  ANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEP
  SSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTP
  NAAWGGEGSLGCGIGYGYLHRIPTQPPSYHKKPPGTPPPSALPLGAPPPDALPPGPTPED
  SPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQ
  RVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEAT
  WSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG
  LDTGTEAEGLDSQAQISTTE

• Sequence length: 440

Pathways

KEGG Pathway	Reactome Pathway
Autophagy - animal	Golgi Cisternae Pericentriolar Stack Reorganization
	COPII-mediated vesicle transport
	COPI-mediated anterograde transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (237)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	26378023		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12458326		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	21901538		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27959400, 30570131, 31671079		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	12214859, 28317833		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17078054, 17493236, 9918209		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25499851, 25820700, 29207489		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	16849549, 20556833		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12722795		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26910375		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12458326		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21161674, 21492457		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16453001, 25706397, 29600938, 30258009		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	15660915		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22084410, 27512062		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30326340		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22984424, 31485664		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23592772, 27454293		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29257205, 31637885		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21683061, 26370562, 28107661		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29932372		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11381677		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29257205, 31637885		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29896252, 30688264, 31579948, 31599399		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15744353		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25369740, 28629334, 28772241		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	25029242		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	31203481		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15029197		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15481028, 22821148, 25544568, 29041983, 29181822, 30052635, 31077746		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	25487615		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17078054, 19157506, 20546338, 26450901		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25369740, 28629334, 28772241		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29573243		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17078054, 24469051, 27046058		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24977159	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22491060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28167529, 29050320, 31770410		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31494123		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21999375, 30911939		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17098279, 23382863, 23640294, 25960241, 31460012, 31545447		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17098279, 23382863, 23640294, 25960241, 31460012, 31545447		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10720133, 12458326		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21161674, 21492457		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	28259870		★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	12458326		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12458326, 15744353		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29932372, 30588579		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28153604, 28216640, 29901086, 30430451, 8782457		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15013430, 24001836, 26942699, 31838134		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22949302, 27175800		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15028307, 15484295, 16284690, 20501702, 22869145, 27338835, 28817833, 30816524, 30825051		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20797985		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21167650, 29935727		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28355355, 29849452		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30581189		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	8782457, 9928378		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	31607634		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	25369740		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20822710, 26209501, 26816250, 28000846, 28482921, 28537665, 28642243, 29072705, 29333456, 31545916		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	21905285, 30665389		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	26907088		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28464025, 29767264, 30551443, 30642981		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15660915, 28713916		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28713916		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	31032942		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28534138		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28534138		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30076618		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29475461		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24608443, 24936866, 28478303, 29104634, 30038056		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29853786, 31599399		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	22438958		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26498772		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23830204		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	31638207		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	21515911		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15660915		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31049785		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22711307		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	24118362, 29679753		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24118362		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29393419		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28402943		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28167529		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22292433		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22292433		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24501220		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24501220		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28038359		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	8234333		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	12722795		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30322331		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	25037760		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31093481		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11381677, 21423202, 24244348, 27994064, 28465487, 28497156, 29062041, 29449895		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11381677, 21423202, 24244348, 27994064, 28465487, 28497156, 29062041, 29449895, 31332862		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28465487, 28969029, 30740911, 30779920, 30978403		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	15200413		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	24501220		★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	28450921		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31572379		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20797985		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18809715, 19208907, 20599797, 25610879, 28148567, 30151392		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31678650		★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	BEFREE	23195252		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30065083		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	18472049		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31252266		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29442198, 30591962, 31841209		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30928090		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	19037255, 29230705, 30519926		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31660818		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	28609207		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29156761, 9928378		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28464025, 30642981		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28646230, 30076618		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30076618		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30808715		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	11753981		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28525373		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30961627		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28315683, 29723660, 31754396		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30257316		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21832251		★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	31236596		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26395262		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12458326, 23445492, 28832545		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12458326, 19079347, 23077289, 23457487, 25092144		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16453001, 25706397, 29600938, 30258009		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	16998793		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16544977, 18972404, 21771706, 22008847, 22293202, 22930530, 23054188, 24760275, 26458400, 28260799, 28423737, 29089476, 29616186, 29988727, 30169594, 30277836, 30455641, 31469428, 31680772		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23195252		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28447718, 29191769		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21771706, 22008847, 22293202		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28295231		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28295231		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12027419, 12847689, 28295231		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28295231		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30542119		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15481028, 17369819, 22821148, 25544568, 29041983, 29181822, 30052635, 31077746		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22711307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22292433		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31187116		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29573243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21771706		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17078054, 24469051, 27046058		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	16998793		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	25487615		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29050320, 31770410		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19880242, 20686216		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12569576, 12727841, 21169414, 24066029, 25749044, 26165401, 26359363, 26450901, 27673408, 31265453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16284690, 24673584, 26934326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12722795, 29525603, 30171715, 31181609		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25369740, 28629334, 28772241		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15028307, 15192014, 15328189, 17403432, 17671195, 18519709, 19201992, 20009901, 22941571, 25405520, 26592237, 26934326, 27454293, 28397014, 28899500, 29065834, 29337531, 29620225, 30014762, 30274235, 30671574, 30993883, 31265453, 31545447, 31770410, 31820042		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17098279, 23382863, 23640294, 25960241, 31460012, 31545447		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15013430, 24001836, 26942699, 31838134		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22941571, 24970818		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21161674, 21492457		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24130172, 25277211, 28821433		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26052894		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	19079347		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28587409		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	16917511		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25565020		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17258784, 17889033, 26062845, 29503661, 29655870, 31362762		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	17380205, 27997693		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19079347		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20482842, 27492973, 28461114		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28355355, 29849452		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19068102, 21442076		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15967702, 20051109, 23975427, 25487615, 31427673		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10416616, 10870681, 11753981, 12740642, 15028307, 15210855, 15561777, 1566083, 16327981, 17078054, 18079962, 19201992, 21901538, 22186294, 22552693, 23300567, 25230791, 25238407, 25499851, 26395262, 26398300, 26487364, 27175800, 27830724, 27989877, 28222771, 28423692, 28545028, 28548219, 28858735, 29017500, 29062041, 29218246, 29467844, 29573243, 30014762, 30169594, 30372446, 30643424, 30740911, 30903649, 30932261, 31221816, 31680772, 31769216, 31770410, 8234333		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	28849172		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	28865949		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20103633, 23071666		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30946927		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	20051109		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31252266		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17078054, 25156800, 26336823, 29363879, 29535539, 30932261		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28829242		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29091322, 30854667		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28478803		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29628496, 29847772, 30387173, 31262893		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29050320, 31770410		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31770410	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	24001836		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19880242		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20556833, 27454293		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	19880242		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29359164		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16849549, 17962362		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26637328, 31181609		★☆☆☆☆ Found in Text Mining only
Pelger-Huet Anomaly	Pelger-Huet Anomaly	BEFREE	8450395		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	30184545		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	25037760, 29287688		★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	28028753		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28402943		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	28734155		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	31236596		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28402943		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12569576, 12727841, 15498932, 24066029, 25749044, 26165401, 26359363, 26450901, 27673408, 31265453		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15328189		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26253870		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28713916, 30551443		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23583295		★☆☆☆☆ Found in Text Mining only
RELA fusion-positive ependymoma	RELA Fusion-Positive Ependymoma	BEFREE	30929114		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31187116		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29935727		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31214773, 31281400		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20494139		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11884470, 19877072, 20822710, 21683061, 23072581, 26370562, 28467992, 28783661, 29784872, 29966968, 30152858, 31239367		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	22139845		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	15972680, 24913772, 26159927, 28800541		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	17040605		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27754829		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	31019235		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11753981, 17237265, 20051109		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16680372, 22186294, 22552693, 26439687, 26718331, 30542119		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30646812		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20716363, 24063540		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29518496, 30250646		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31061316		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18290776		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	15200413		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11751513, 16284690, 24673584, 26934326		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30018671		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22139845		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30946927		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12722795, 29525603, 30014762, 30171715, 31181609, 9365245		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	12722795		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29525603, 30171715, 31181609		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27393618, 29487338, 30612216		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15133865, 15753535, 18996285, 19369513, 31714673, 9928378		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	31837307		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GOLGA2 3 shared pathwaysCOPI-mediated anterograde transport, COPII-mediated vesicle transport, Golgi Cisternae Pericentriolar Stack Reorganization Related via 3 shared pathways including COPI-mediated anterograde transport, COPII-mediated vesicle transport. YKT6 3 shared pathwaysAutophagy - animal, COPI-mediated anterograde transport, COPII-mediated vesicle transport Related via 3 shared pathways including Autophagy - animal, COPI-mediated anterograde transport. GORASP2 2 shared pathwaysAutophagy - animal, Golgi Cisternae Pericentriolar Stack Reorganization Related via 2 shared pathways including Autophagy - animal, Golgi Cisternae Pericentriolar Stack Reorganization. USO1 2 shared pathwaysCOPI-mediated anterograde transport, COPII-mediated vesicle transport Related via 2 shared pathways including COPI-mediated anterograde transport, COPII-mediated vesicle transport. RAB1A 4 shared pathwaysAutophagy - animal, COPI-mediated anterograde transport, COPII-mediated vesicle transport, Golgi Cisternae Pericentriolar Stack Reorganization Related via 4 shared pathways including Autophagy - animal, COPI-mediated anterograde transport.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GOLGA2	0	[]	3	["COPI-mediated anterograde transport","COPII-mediated vesicle transport","Golgi Cisternae Pericentriolar Stack Reorganization"]	0	[]
YKT6	0	[]	3	["Autophagy - animal","COPI-mediated anterograde transport","COPII-mediated vesicle transport"]	0	[]
GORASP2	0	[]	2	["Autophagy - animal","Golgi Cisternae Pericentriolar Stack Reorganization"]	0	[]
USO1	0	[]	2	["COPI-mediated anterograde transport","COPII-mediated vesicle transport"]	0	[]
RAB1A	0	[]	4	["Autophagy - animal","COPI-mediated anterograde transport","COPII-mediated vesicle transport","Golgi Cisternae Pericentriolar Stack Reorganization"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 2 of 5 related genesYKT6, RAB1A Developmental delay with hypotonia, myopathy, and brain abnormalities Linked via 1 of 5 related genesGOLGA2 Neuromuscular disease Linked via 1 of 5 related genesGOLGA2 Metabolic syndrome Linked via 1 of 5 related genesYKT6 Scoliosis Linked via 1 of 5 related genesGORASP2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	2	["YKT6","RAB1A"]
Developmental delay with hypotonia, myopathy, and brain abnormalities	1	["GOLGA2"]
Neuromuscular disease	1	["GOLGA2"]
Metabolic syndrome	1	["YKT6"]
Scoliosis	1	["GORASP2"]