GOLGA6A (golgin A6 family member A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 342096
Gene name Golgin A6 family member A
Gene symbol GOLGA6A
Synonyms (NCBI Gene)
GLPGOLGA6
Chromosome 15
Chromosome location 15q24.1
Summary The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be
miRNA miRNA information provided by mirtarbase database.
44 Show/Hide all (44)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT004173 hsa-miR-192-5p Microarray 16822819
MIRT017757 hsa-miR-335-5p Microarray 18185580
MIRT714704 hsa-miR-383-3p HITS-CLIP 19536157
MIRT714703 hsa-miR-450b-5p HITS-CLIP 19536157
MIRT714704 hsa-miR-383-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000137 Component Golgi cis cisterna IBA
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005794 Component Golgi apparatus IEA
GO:0005801 Component Cis-Golgi network IBA
GO:0007030 Process Golgi organization IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610288 13567 ENSG00000159289
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYA3
Protein name Golgin subfamily A member 6A (Golgin linked to PML) (Golgin-like protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15070 GOLGA2L5 217 → 364 Putative golgin subfamily A member 2-like protein 5 Coiled-coil
PF15070 GOLGA2L5 530 → 628 Putative golgin subfamily A member 2-like protein 5 Coiled-coil
PF15070 GOLGA2L5 468 → 536 Putative golgin subfamily A member 2-like protein 5 Coiled-coil
PF19046 GM130_C 673 → 693 GM130 C-terminal binding motif Motif
Tissue specificity TISSUE SPECIFICITY: Highly expressed in seminiferous tubes in testis. Highly expressed in spermatids, barely detectable in late pachytene spermatocytes, and not detectable in spermatogonia. Detected at intermediate levels in pancreas and lymph nodes, and
Sequence 
MWPQPYLPPHPMMLEESRQNKLAAAKKKLKEYQQRKSPGIPAGAKTKKKKTDSSPETTTS
GGCHSPGDSQYQELAVALESSSVTISQLNENIESLKQQKKQVEHQLEEAKKTNNEIHKAQ
MERLETINILTLEKADLKTTLYHTKRAARHFEEESKDLAGRLQYSLQRIQELERALCAVS
TQQQEEDRSSSCREAVLQRWLQQTIKERALLNAHVTQVTESLKQVQLERDEYAKHIKGER
ARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKNQMAEPPSLAPPAVTSVVEQL
QDEAKHLRQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQEAQRVREQERL
CEQNERLREQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKE
ERLQKQEERLALSQNHKLDKQLAEPQCSFEDLNNEKKSALQLEQQVKELQEKLDEEHLEA
ASHQNQQLETQLSLVALPGEGDGGQHLDSEEEEAPRPTPNIPEDLESREATSSFMDLPKE
KADGTEQVERRELGFVQPSGVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLAQKEEEMK
VKLLELQELVLPLVGNHEGHGKFLIAAQNPADEPTPGAPAPQELGAAGEQDVFYEVSLDN
NVEPAPGAAREGSPHDNPTVQQIVQLSPVMQDT
Sequence length 693
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (69)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 28102093, 29463450
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 28105738, 28249585
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease, Early Onset Alzheimer disease BEFREE 31804189
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyloidosis Amyloidosis BEFREE 30465895
★★★★★
★☆☆☆☆
Found in Text Mining only
Anorexia Anorexia BEFREE 27908915, 28811293, 29949410
★★★★★
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 31270216
★★★★★
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 31270216
★★★★★
★☆☆☆☆
Found in Text Mining only
Bipolar Disorder Bipolar Disorder BEFREE 30954559
★★★★★
★☆☆☆☆
Found in Text Mining only
Brain Ischemia Cerebral Ischemia BEFREE 31680842
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 29259012
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for GOLGA6A.

No additional diseases found yet through genes similar to GOLGA6A.