GNG14 (G protein subunit gamma 14) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	105372280
Gene name	G protein subunit gamma 14
Gene symbol	GNG14
Synonyms (NCBI Gene)	HG3K
Chromosome	19
Chromosome location	19p13.13

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005834	Component	Heterotrimeric G-protein complex	IBA
GO:0005834	Component	Heterotrimeric G-protein complex	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0031681	Function	G-protein beta-subunit binding	IBA
GO:0031681	Function	G-protein beta-subunit binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	A0A1W2PPG7
Protein name	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-14
Protein function	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G prote
Family and domains
Sequence	MSSKVAINSDIGQALWAVEQLQMEAGIDQVKMAADLLKFCTEQAKNDPFLVGIPAATNSF KEKKPYAIL
Sequence length	69
Interactions	View interactions