Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	2770
Gene name	G protein subunit alpha i1
Gene symbol	GNAI1
Synonyms (NCBI Gene)	GiHG1BNEDHISB
Chromosome	7
Chromosome location	7q21.11
Summary	Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The alpha subunit binds guanine nucleotide, can hydrolyze GTP, and can interact with other proteins. The protein encoded by

334

Show/Hide all (334)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021108	hsa-miR-186-5p	Sequencing	20371350
MIRT023552	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT054488	hsa-miR-320a	Luciferase reporter assayWestern blotImmunohistochemical (IHC) staining	23691483
MIRT054489	hsa-miR-320c	Luciferase reporter assayWestern blotImmunohistochemical (IHC) staining	23691483
MIRT054490	hsa-miR-320d	Luciferase reporter assayWestern blotImmunohistochemical (IHC) staining	23691483
MIRT054491	hsa-miR-9-3p	Luciferase reporter assayWestern blotImmunohistochemical (IHC) staining	23691483
MIRT610892	hsa-miR-8485	HITS-CLIP	23313552
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT626104	hsa-miR-603	HITS-CLIP	23313552
MIRT610891	hsa-miR-4719	HITS-CLIP	23313552
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23313552
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23313552
MIRT626103	hsa-miR-3941	HITS-CLIP	23313552
MIRT626102	hsa-miR-4672	HITS-CLIP	23313552
MIRT626101	hsa-miR-466	HITS-CLIP	23313552
MIRT610892	hsa-miR-8485	HITS-CLIP	23313552
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT626104	hsa-miR-603	HITS-CLIP	23313552
MIRT610891	hsa-miR-4719	HITS-CLIP	23313552
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23313552
MIRT626103	hsa-miR-3941	HITS-CLIP	23313552
MIRT626101	hsa-miR-466	HITS-CLIP	23313552
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT626106	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT626105	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT626105	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT626103	hsa-miR-3941	HITS-CLIP	27418678
MIRT626103	hsa-miR-3941	HITS-CLIP	27418678
MIRT671961	hsa-miR-409-5p	HITS-CLIP	27418678
MIRT626101	hsa-miR-466	HITS-CLIP	27418678
MIRT626101	hsa-miR-466	HITS-CLIP	27418678
MIRT626102	hsa-miR-4672	HITS-CLIP	27418678
MIRT626102	hsa-miR-4672	HITS-CLIP	27418678
MIRT610891	hsa-miR-4719	HITS-CLIP	27418678
MIRT610891	hsa-miR-4719	HITS-CLIP	27418678
MIRT626104	hsa-miR-603	HITS-CLIP	27418678
MIRT626104	hsa-miR-603	HITS-CLIP	27418678
MIRT610892	hsa-miR-8485	HITS-CLIP	27418678
MIRT610892	hsa-miR-8485	HITS-CLIP	27418678
MIRT610892	hsa-miR-8485	HITS-CLIP	23313552
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT626104	hsa-miR-603	HITS-CLIP	23313552
MIRT610891	hsa-miR-4719	HITS-CLIP	23313552
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23313552
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23313552
MIRT626103	hsa-miR-3941	HITS-CLIP	23313552
MIRT626102	hsa-miR-4672	HITS-CLIP	23313552
MIRT626101	hsa-miR-466	HITS-CLIP	23313552
MIRT610892	hsa-miR-8485	HITS-CLIP	23313552
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT626104	hsa-miR-603	HITS-CLIP	23313552
MIRT610891	hsa-miR-4719	HITS-CLIP	23313552
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23313552
MIRT626103	hsa-miR-3941	HITS-CLIP	23313552
MIRT626101	hsa-miR-466	HITS-CLIP	23313552
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT1023158	hsa-miR-141	CLIP-seq
MIRT1023159	hsa-miR-200a	CLIP-seq
MIRT1023160	hsa-miR-205	CLIP-seq
MIRT1023161	hsa-miR-3201	CLIP-seq
MIRT1023162	hsa-miR-329	CLIP-seq
MIRT1023163	hsa-miR-3691-5p	CLIP-seq
MIRT1023164	hsa-miR-4491	CLIP-seq
MIRT1023165	hsa-miR-4657	CLIP-seq
MIRT1023166	hsa-miR-4752	CLIP-seq
MIRT1023167	hsa-miR-4791	CLIP-seq
MIRT1023168	hsa-miR-5095	CLIP-seq
MIRT1023169	hsa-miR-513b	CLIP-seq
MIRT1023170	hsa-miR-584	CLIP-seq
MIRT1023162	hsa-miR-329	CLIP-seq
MIRT2236288	hsa-miR-133a	CLIP-seq
MIRT2236289	hsa-miR-133b	CLIP-seq
MIRT1023162	hsa-miR-329	CLIP-seq
MIRT2236290	hsa-miR-4282	CLIP-seq
MIRT2236291	hsa-miR-4766-5p	CLIP-seq
MIRT1023170	hsa-miR-584	CLIP-seq
MIRT2236292	hsa-miR-624	CLIP-seq
MIRT2236293	hsa-miR-9	CLIP-seq
MIRT2429375	hsa-miR-3143	CLIP-seq
MIRT2429376	hsa-miR-3689a-5p	CLIP-seq
MIRT2429377	hsa-miR-3689b	CLIP-seq
MIRT2429378	hsa-miR-3689e	CLIP-seq
MIRT2429379	hsa-miR-3689f	CLIP-seq
MIRT2429380	hsa-miR-4775	CLIP-seq
MIRT2429381	hsa-miR-4803	CLIP-seq
MIRT2429382	hsa-miR-548a-5p	CLIP-seq
MIRT2429383	hsa-miR-548ab	CLIP-seq
MIRT2429384	hsa-miR-548ak	CLIP-seq
MIRT2429385	hsa-miR-548b-5p	CLIP-seq
MIRT2429386	hsa-miR-548c-5p	CLIP-seq
MIRT2429387	hsa-miR-548d-5p	CLIP-seq
MIRT2429388	hsa-miR-548h	CLIP-seq
MIRT2429389	hsa-miR-548i	CLIP-seq
MIRT2429390	hsa-miR-548j	CLIP-seq
MIRT2429391	hsa-miR-548w	CLIP-seq
MIRT2429392	hsa-miR-548y	CLIP-seq
MIRT2429393	hsa-miR-559	CLIP-seq
MIRT2429394	hsa-miR-590-3p	CLIP-seq
MIRT2429395	hsa-miR-648	CLIP-seq
MIRT1023158	hsa-miR-141	CLIP-seq
MIRT1023159	hsa-miR-200a	CLIP-seq
MIRT2429375	hsa-miR-3143	CLIP-seq
MIRT2437445	hsa-miR-3663-3p	CLIP-seq
MIRT2429376	hsa-miR-3689a-5p	CLIP-seq
MIRT2429377	hsa-miR-3689b	CLIP-seq
MIRT2429378	hsa-miR-3689e	CLIP-seq
MIRT2429379	hsa-miR-3689f	CLIP-seq
MIRT2429380	hsa-miR-4775	CLIP-seq
MIRT2437446	hsa-miR-4789-3p	CLIP-seq
MIRT2429381	hsa-miR-4803	CLIP-seq
MIRT2429382	hsa-miR-548a-5p	CLIP-seq
MIRT2429383	hsa-miR-548ab	CLIP-seq
MIRT2429384	hsa-miR-548ak	CLIP-seq
MIRT2429385	hsa-miR-548b-5p	CLIP-seq
MIRT2429386	hsa-miR-548c-5p	CLIP-seq
MIRT2429387	hsa-miR-548d-5p	CLIP-seq
MIRT2429388	hsa-miR-548h	CLIP-seq
MIRT2429389	hsa-miR-548i	CLIP-seq
MIRT2429390	hsa-miR-548j	CLIP-seq
MIRT2429391	hsa-miR-548w	CLIP-seq
MIRT2429392	hsa-miR-548y	CLIP-seq
MIRT2429393	hsa-miR-559	CLIP-seq
MIRT2429394	hsa-miR-590-3p	CLIP-seq
MIRT2429395	hsa-miR-648	CLIP-seq
MIRT2539999	hsa-miR-1237	CLIP-seq
MIRT2540000	hsa-miR-1248	CLIP-seq
MIRT2540001	hsa-miR-1298	CLIP-seq
MIRT2236288	hsa-miR-133a	CLIP-seq
MIRT2236289	hsa-miR-133b	CLIP-seq
MIRT1023158	hsa-miR-141	CLIP-seq
MIRT1023159	hsa-miR-200a	CLIP-seq
MIRT2540002	hsa-miR-23a	CLIP-seq
MIRT2540003	hsa-miR-23b	CLIP-seq
MIRT2540004	hsa-miR-23c	CLIP-seq
MIRT2540005	hsa-miR-3152-5p	CLIP-seq
MIRT2540006	hsa-miR-3182	CLIP-seq
MIRT2540007	hsa-miR-330-3p	CLIP-seq
MIRT2540008	hsa-miR-34b	CLIP-seq
MIRT2540009	hsa-miR-3647-3p	CLIP-seq
MIRT2540010	hsa-miR-3653	CLIP-seq
MIRT2540011	hsa-miR-3658	CLIP-seq
MIRT2437445	hsa-miR-3663-3p	CLIP-seq
MIRT2540012	hsa-miR-4263	CLIP-seq
MIRT2540013	hsa-miR-4420	CLIP-seq
MIRT2540014	hsa-miR-4477a	CLIP-seq
MIRT2540015	hsa-miR-4652-3p	CLIP-seq
MIRT2540016	hsa-miR-4774-3p	CLIP-seq
MIRT2437446	hsa-miR-4789-3p	CLIP-seq
MIRT2540017	hsa-miR-4797-3p	CLIP-seq
MIRT2540018	hsa-miR-576-5p	CLIP-seq
MIRT2540019	hsa-miR-586	CLIP-seq
MIRT2540020	hsa-miR-595	CLIP-seq
MIRT2540021	hsa-miR-616	CLIP-seq
MIRT2540022	hsa-miR-633	CLIP-seq
MIRT2540023	hsa-miR-642b	CLIP-seq
MIRT2236293	hsa-miR-9	CLIP-seq
MIRT2540024	hsa-miR-935	CLIP-seq
MIRT2540025	hsa-miR-944	CLIP-seq
MIRT2540023	hsa-miR-642b	CLIP-seq

Show/Hide all (79)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	8774883
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0003924	Function	GTPase activity	TAS	2834384
GO:0003925	Function	G protein activity	IDA	16204467, 33762731, 35817871, 38428423, 38503280
GO:0005515	Function	Protein binding	IPI	15537540, 18434541, 21988832, 22952234, 25416956, 32296183, 33961781
GO:0005525	Function	GTP binding	IDA	34685729
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17635935
GO:0005737	Component	Cytoplasm	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IDA	17635935
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA	17635935
GO:0005829	Component	Cytosol	IDA
GO:0005834	Component	Heterotrimeric G-protein complex	IBA
GO:0005834	Component	Heterotrimeric G-protein complex	IDA	33762731, 34239069
GO:0005834	Component	Heterotrimeric G-protein complex	TAS	3110783
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	17635935, 23027904, 26766442
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3139448
GO:0005938	Component	Cell cortex	IDA	22327364, 23870127
GO:0005938	Component	Cell cortex	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	ISS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	38503280
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	16204467, 34239069, 35817871, 38428423, 38503280
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	33762731, 34239069
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	ISS
GO:0010854	Function	Adenylate cyclase regulator activity	IDA	33762731
GO:0010855	Function	Adenylate cyclase inhibitor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019001	Function	Guanyl nucleotide binding	IEA
GO:0019003	Function	GDP binding	ISS
GO:0030496	Component	Midbody	IDA	17635935
GO:0030496	Component	Midbody	IEA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IBA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0031749	Function	D2 dopamine receptor binding	IPI	33571431
GO:0031821	Function	G protein-coupled serotonin receptor binding	IBA
GO:0034451	Component	Centriolar satellite	IDA
GO:0034695	Process	Response to prostaglandin E	IDA	16204467
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0043434	Process	Response to peptide hormone	ISS
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	38503280
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	38503280
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0051301	Process	Cell division	IMP	17635935
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	23027904
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	35570218
GO:0072678	Process	T cell migration	IDA	20829352
GO:1901082	Process	Positive regulation of relaxation of smooth muscle	ISS	9843699
GO:1904322	Process	Cellular response to forskolin	ISS
GO:1904778	Process	Positive regulation of protein localization to cell cortex	IMP	22327364, 23027904, 26766442

MIM	HGNC	e!Ensembl
139310	4384	ENSG00000127955

P63096

Protein name

Guanine nucleotide-binding protein G(i) subunit alpha-1 (EC 3.6.5.-) (Adenylate cyclase-inhibiting G alpha protein)

Protein function

Guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs) in numerous signaling cascades (PubMed:18434541, PubMed:33762731, PubMed:34239069, PubMed:35610220, PubMed:37935376, PubMe

PDB

1KJY , 1Y3A , 2G83 , 2GTP , 2IK8 , 2OM2 , 2XNS , 3ONW , 3QE0 , 3QI2 , 3UMR , 3UMS , 4G5Q , 5JS7 , 5JS8 , 5TDH , 6CMO , 6CRK , 6DDE , 6DDF , 6KPF , 6KPG , 6LFM , 6LFO , 6LML , 6N4B , 6OMM , 6OS9 , 6OSA , 6OT0 , 6PB0 , 6PB1 , 6PT0 , 6QNO , 6VU8 , 6XBJ , 6XBK , 6XBL , 6XBM , 7CMU , 7CMV , 7DB6 , 7DW9 , 7E2X , 7E2Y , 7E2Z , 7E32 , 7E33 , 7E9G , 7EB2 , 7EJX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00503	G-alpha	13 → 343	G-protein alpha subunit	Domain

Sequence

MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

Sequence length

354

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental abnormality	Likely pathogenic	rs1787388036	RCV001264620	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs1788434338	RCV001095673	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with hypotonia, impaired speech, and behavioral abnormalities	Pathogenic; Likely pathogenic	rs1788864590, rs2115712706, rs2115683966, rs2116052322, rs2115727431, rs2115712676, rs2115712712, rs1788863320, rs2115631937, rs1788436294, rs1788434338	RCV002246432 RCV004762190 RCV004594596 RCV002249061 RCV002248390 View all (6 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Seizure	Likely pathogenic	rs1788434297	RCV001526691	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GNAI1 associated Neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GNAI1-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT RENAL PELVIS NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (45)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	22982105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	CTD_human_DG	11350863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety disorder	Pubtator	28969474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	36959563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	25918132		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	29307797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	35296084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34685729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23591873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29307797, 29693178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	9362361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26043775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	12609843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30836096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30836096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34796980, 35845138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	33473207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	30389790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26043775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29658578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33473207, 34685729	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	8670119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33149760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	33473207, 34685729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	8888689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29307797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	8434024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	1811054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	11688759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	33473207, 34685729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30836096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	34685729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30836096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37545226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34685729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20975297	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29658578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19116446, 29693178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37947401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	9121362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20663860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26043775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	33473207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	22982105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32337286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GNAI1 (G protein subunit alpha i1)