GLYCAM1 (glycosylation dependent cell adhesion molecule 1 (pseudogene))
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 644076 |
| Gene name | Glycosylation dependent cell adhesion molecule 1 (pseudogene) |
| Gene symbol | GLYCAM1 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 12 |
| Chromosome location | 12q13.2 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8IVK1 |
| Protein name | Putative glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in cells harvested from milk of lactating women. Not found in other tissues. {ECO:0000269|PubMed:12057858}. |
| Sequence |
MKFFMVLLPASLASTSLAILDVESGLLPQLSVLLSNRLRGKTCQTGP |
| Sequence length | 47 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with GLYCAM1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to GLYCAM1 (see Related Genes above), that are NOT already directly curated for GLYCAM1 itself -- a lead worth checking, not a confirmed association.
0
|
|