GLYATL2 (glycine-N-acyltransferase like 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 219970
Gene name Glycine-N-acyltransferase like 2
Gene symbol GLYATL2
Synonyms (NCBI Gene)
BXMAS2-10GATF-B
Chromosome 11
Chromosome location 11q12.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IEA
GO:0005783 Component Endoplasmic reticulum IDA 20305126
GO:0005783 Component Endoplasmic reticulum IEA
GO:0006629 Process Lipid metabolic process IEA
GO:0016740 Function Transferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614762 24178 ENSG00000156689
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WU03
Protein name Glycine N-acyltransferase-like protein 2 (EC 2.3.1.13) (Acyl-CoA:glycine N-acyltransferase-like protein 2)
Protein function Mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine (PubMed:20305126, PubMed:22475485). Conjugates numerous substrates, such as arachidonoyl-CoA and saturated medium and long-chain acyl-CoAs ranging from cha
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06021 Gly_acyl_tr_N 1 → 201 Aralkyl acyl-CoA:amino acid N-acyltransferase Family
PF08444 Gly_acyl_tr_C 202 → 290 Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region Family
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in salivary gland and trachea. Also detected in thyroid gland, spinal cord, prostate, lung and fetal brain. {ECO:0000269|PubMed:20305126}.
Sequence 
MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQ
KQEMKDDQDHYTNTYHIFTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATS
KSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHW
AFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQ
IGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC
Sequence length 294
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Conjugation of salicylate with glycine
Conjugation of benzoate with glycine
Sort by:
GLYAT 2 shared pathwaysConjugation of salicylate with glycine, Conjugation of benzoate with glycine Related via 2 shared pathways including Conjugation of salicylate with glycine, Conjugation of benzoate with glycine. GLYATL3 2 shared pathwaysConjugation of salicylate with glycine, Conjugation of benzoate with glycine Related via 2 shared pathways including Conjugation of salicylate with glycine, Conjugation of benzoate with glycine. GLYATL1 2 shared pathwaysConjugation of salicylate with glycine, Conjugation of benzoate with glycine Related via 2 shared pathways including Conjugation of salicylate with glycine, Conjugation of benzoate with glycine. ACSM2B 2 shared pathwaysConjugation of salicylate with glycine, Conjugation of benzoate with glycine Related via 2 shared pathways including Conjugation of salicylate with glycine, Conjugation of benzoate with glycine.
Ankylosing spondylitis Linked via 1 of 4 related genesGLYAT Bipolar disorder Linked via 1 of 4 related genesGLYAT Cardiovascular disease Linked via 1 of 4 related genesGLYAT Crohn disease Linked via 1 of 4 related genesGLYAT Inflammatory bowel disease Linked via 1 of 4 related genesGLYAT