GLUL (glutamate-ammonia ligase)

Gene

• Entrez ID: 2752
• Gene name: Glutamate-ammonia ligase
• Gene symbol: GLUL
• Synonyms (NCBI Gene): DEE116, GLNS, GS, PIG43, PIG59
• Chromosome: 1
• Chromosome location: 1q25.3
• Summary: The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base home

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs80358214	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs80358215	G>A	Pathogenic	Missense variant, coding sequence variant
rs1131691970	T>A	Likely-pathogenic	Initiator codon variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004021	hsa-miR-29a-3p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	19951903
MIRT004021	hsa-miR-29a-3p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	19951903
MIRT021141	hsa-miR-186-5p	Sequencing	20371350
MIRT025018	hsa-miR-183-5p	Sequencing	20371350
MIRT030540	hsa-miR-24-3p	Sequencing	20371350
MIRT052399	hsa-let-7a-5p	CLASH	23622248
MIRT052399	hsa-let-7a-5p	CLASH	23622248
MIRT051664	hsa-let-7e-5p	CLASH	23622248
MIRT051362	hsa-let-7f-5p	CLASH	23622248
MIRT048155	hsa-miR-196a-5p	CLASH	23622248
MIRT045626	hsa-miR-149-5p	CLASH	23622248
MIRT045330	hsa-miR-185-5p	CLASH	23622248
MIRT044856	hsa-miR-320a	CLASH	23622248
MIRT041957	hsa-miR-484	CLASH	23622248
MIRT040016	hsa-miR-615-3p	CLASH	23622248
MIRT038640	hsa-miR-125a-3p	CLASH	23622248
MIRT038394	hsa-miR-296-3p	CLASH	23622248
MIRT038153	hsa-miR-423-5p	CLASH	23622248
MIRT037273	hsa-miR-877-5p	CLASH	23622248
MIRT036966	hsa-miR-877-3p	CLASH	23622248
MIRT036638	hsa-miR-937-3p	CLASH	23622248
MIRT036244	hsa-miR-320b	CLASH	23622248
MIRT710654	hsa-miR-6514-5p	HITS-CLIP	19536157
MIRT710653	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT710652	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT710651	hsa-miR-143-3p	HITS-CLIP	19536157
MIRT710650	hsa-miR-4770	HITS-CLIP	19536157
MIRT710649	hsa-miR-6088	HITS-CLIP	19536157
MIRT710648	hsa-miR-4708-5p	HITS-CLIP	19536157
MIRT710647	hsa-miR-1273f	HITS-CLIP	19536157
MIRT710646	hsa-miR-4534	HITS-CLIP	19536157
MIRT710645	hsa-miR-8082	HITS-CLIP	19536157
MIRT710644	hsa-miR-4653-3p	HITS-CLIP	19536157
MIRT710643	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT710642	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT710641	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT710640	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT710639	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT710638	hsa-miR-8055	HITS-CLIP	19536157
MIRT710637	hsa-miR-129-5p	HITS-CLIP	19536157
MIRT688092	hsa-miR-495-5p	HITS-CLIP	23313552
MIRT688091	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688090	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688089	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT688088	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT688087	hsa-miR-940	HITS-CLIP	23313552
MIRT688086	hsa-miR-3929	HITS-CLIP	23313552
MIRT688085	hsa-miR-4419b	HITS-CLIP	23313552
MIRT688084	hsa-miR-4478	HITS-CLIP	23313552
MIRT688083	hsa-miR-1298-3p	HITS-CLIP	23313552
MIRT688082	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT688081	hsa-miR-204-3p	HITS-CLIP	23313552
MIRT688080	hsa-miR-4646-5p	HITS-CLIP	23313552
MIRT523532	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688079	hsa-miR-1827	HITS-CLIP	23313552
MIRT688078	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT688077	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT688076	hsa-miR-298	HITS-CLIP	23313552
MIRT688075	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT688074	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT688073	hsa-miR-3612	HITS-CLIP	23313552
MIRT688072	hsa-miR-650	HITS-CLIP	23313552
MIRT688071	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT688070	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT688069	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT688068	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT688067	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT688066	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT688065	hsa-miR-4314	HITS-CLIP	23313552
MIRT688064	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688063	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT688062	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT688061	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT688060	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT688059	hsa-miR-3689c	HITS-CLIP	23313552
MIRT688058	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT688057	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT688056	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT688055	hsa-miR-665	HITS-CLIP	23313552
MIRT688054	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT688053	hsa-miR-383-5p	HITS-CLIP	23313552
MIRT688052	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT688051	hsa-miR-4459	HITS-CLIP	23313552
MIRT688050	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT688049	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT688048	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT688047	hsa-miR-4772-5p	HITS-CLIP	23313552
MIRT688046	hsa-miR-4683	HITS-CLIP	23313552
MIRT688045	hsa-miR-3926	HITS-CLIP	23313552
MIRT523524	hsa-miR-6878-5p	HITS-CLIP	23313552
MIRT523523	hsa-miR-6731-5p	HITS-CLIP	23313552
MIRT523522	hsa-miR-8085	HITS-CLIP	23313552
MIRT688044	hsa-miR-548s	HITS-CLIP	23313552
MIRT523512	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT523511	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT523510	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT663730	hsa-miR-4418	HITS-CLIP	23824327
MIRT663729	hsa-miR-509-3-5p	HITS-CLIP	23824327
MIRT663728	hsa-miR-509-5p	HITS-CLIP	23824327
MIRT663727	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT663726	hsa-miR-1184	HITS-CLIP	23824327
MIRT663725	hsa-miR-4660	HITS-CLIP	23824327
MIRT663724	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT663723	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT663722	hsa-miR-4420	HITS-CLIP	23824327
MIRT663721	hsa-miR-653-3p	HITS-CLIP	23824327
MIRT663720	hsa-miR-1301-3p	HITS-CLIP	23824327
MIRT663719	hsa-miR-5047	HITS-CLIP	23824327
MIRT523535	hsa-miR-4511	PAR-CLIP	23446348
MIRT523534	hsa-miR-4716-3p	PAR-CLIP	23446348
MIRT523533	hsa-miR-6794-5p	PAR-CLIP	23446348
MIRT523532	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT523531	hsa-miR-3185	PAR-CLIP	23446348
MIRT523530	hsa-miR-549a	PAR-CLIP	23446348
MIRT523529	hsa-miR-4481	PAR-CLIP	23446348
MIRT523528	hsa-miR-4745-5p	PAR-CLIP	23446348
MIRT523527	hsa-miR-571	PAR-CLIP	23446348
MIRT523526	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT523525	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT523524	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT523523	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT523522	hsa-miR-8085	PAR-CLIP	23446348
MIRT523521	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT523520	hsa-miR-4271	PAR-CLIP	23446348
MIRT523519	hsa-miR-4725-3p	PAR-CLIP	23446348
MIRT523518	hsa-miR-6780b-5p	PAR-CLIP	23446348
MIRT523517	hsa-miR-625-5p	PAR-CLIP	23446348
MIRT523516	hsa-miR-4654	PAR-CLIP	23446348
MIRT523515	hsa-miR-4769-5p	PAR-CLIP	23446348
MIRT523514	hsa-miR-3198	PAR-CLIP	23446348
MIRT523513	hsa-miR-4309	PAR-CLIP	23446348
MIRT523512	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT523511	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT523510	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT523509	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT710654	hsa-miR-6514-5p	HITS-CLIP	19536157
MIRT710653	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT710652	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT710651	hsa-miR-143-3p	HITS-CLIP	19536157
MIRT710650	hsa-miR-4770	HITS-CLIP	19536157
MIRT710649	hsa-miR-6088	HITS-CLIP	19536157
MIRT710648	hsa-miR-4708-5p	HITS-CLIP	19536157
MIRT710647	hsa-miR-1273f	HITS-CLIP	19536157
MIRT710646	hsa-miR-4534	HITS-CLIP	19536157
MIRT710645	hsa-miR-8082	HITS-CLIP	19536157
MIRT710644	hsa-miR-4653-3p	HITS-CLIP	19536157
MIRT710643	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT710642	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT710641	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT710640	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT710639	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT710638	hsa-miR-8055	HITS-CLIP	19536157
MIRT710637	hsa-miR-129-5p	HITS-CLIP	19536157
MIRT688092	hsa-miR-495-5p	HITS-CLIP	23313552
MIRT688091	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688090	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688089	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT688088	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT688087	hsa-miR-940	HITS-CLIP	23313552
MIRT688086	hsa-miR-3929	HITS-CLIP	23313552
MIRT688085	hsa-miR-4419b	HITS-CLIP	23313552
MIRT688084	hsa-miR-4478	HITS-CLIP	23313552
MIRT688083	hsa-miR-1298-3p	HITS-CLIP	23313552
MIRT688082	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT688081	hsa-miR-204-3p	HITS-CLIP	23313552
MIRT688080	hsa-miR-4646-5p	HITS-CLIP	23313552
MIRT523532	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688079	hsa-miR-1827	HITS-CLIP	23313552
MIRT688078	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT688077	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT688076	hsa-miR-298	HITS-CLIP	23313552
MIRT688075	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT688074	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT688073	hsa-miR-3612	HITS-CLIP	23313552
MIRT688072	hsa-miR-650	HITS-CLIP	23313552
MIRT688071	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT688070	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT688069	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT688068	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT688067	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT688066	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT688065	hsa-miR-4314	HITS-CLIP	23313552
MIRT688064	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688063	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT688062	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT688061	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT688060	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT688059	hsa-miR-3689c	HITS-CLIP	23313552
MIRT688058	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT688057	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT688056	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT688055	hsa-miR-665	HITS-CLIP	23313552
MIRT688054	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT688053	hsa-miR-383-5p	HITS-CLIP	23313552
MIRT688052	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT688051	hsa-miR-4459	HITS-CLIP	23313552
MIRT688050	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT688049	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT688048	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT688047	hsa-miR-4772-5p	HITS-CLIP	23313552
MIRT688046	hsa-miR-4683	HITS-CLIP	23313552
MIRT688045	hsa-miR-3926	HITS-CLIP	23313552
MIRT523524	hsa-miR-6878-5p	HITS-CLIP	23313552
MIRT523523	hsa-miR-6731-5p	HITS-CLIP	23313552
MIRT523522	hsa-miR-8085	HITS-CLIP	23313552
MIRT688044	hsa-miR-548s	HITS-CLIP	23313552
MIRT523512	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT523511	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT523510	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT663730	hsa-miR-4418	HITS-CLIP	23824327
MIRT663729	hsa-miR-509-3-5p	HITS-CLIP	23824327
MIRT663728	hsa-miR-509-5p	HITS-CLIP	23824327
MIRT663727	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT663726	hsa-miR-1184	HITS-CLIP	23824327
MIRT663725	hsa-miR-4660	HITS-CLIP	23824327
MIRT663724	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT663723	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT663722	hsa-miR-4420	HITS-CLIP	23824327
MIRT663721	hsa-miR-653-3p	HITS-CLIP	23824327
MIRT663720	hsa-miR-1301-3p	HITS-CLIP	23824327
MIRT663719	hsa-miR-5047	HITS-CLIP	23824327
MIRT523535	hsa-miR-4511	PAR-CLIP	23446348
MIRT523534	hsa-miR-4716-3p	PAR-CLIP	23446348
MIRT523533	hsa-miR-6794-5p	PAR-CLIP	23446348
MIRT523532	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT523531	hsa-miR-3185	PAR-CLIP	23446348
MIRT523530	hsa-miR-549a	PAR-CLIP	23446348
MIRT523529	hsa-miR-4481	PAR-CLIP	23446348
MIRT523528	hsa-miR-4745-5p	PAR-CLIP	23446348
MIRT523527	hsa-miR-571	PAR-CLIP	23446348
MIRT523526	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT523525	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT523524	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT523523	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT523522	hsa-miR-8085	PAR-CLIP	23446348
MIRT523521	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT523520	hsa-miR-4271	PAR-CLIP	23446348
MIRT523519	hsa-miR-4725-3p	PAR-CLIP	23446348
MIRT523518	hsa-miR-6780b-5p	PAR-CLIP	23446348
MIRT523517	hsa-miR-625-5p	PAR-CLIP	23446348
MIRT523516	hsa-miR-4654	PAR-CLIP	23446348
MIRT523515	hsa-miR-4769-5p	PAR-CLIP	23446348
MIRT523514	hsa-miR-3198	PAR-CLIP	23446348
MIRT523513	hsa-miR-4309	PAR-CLIP	23446348
MIRT523512	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT523511	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT523510	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT523509	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT1022008	hsa-miR-223	CLIP-seq
MIRT1022009	hsa-miR-2276	CLIP-seq
MIRT1022010	hsa-miR-3194-3p	CLIP-seq
MIRT1022011	hsa-miR-323b-3p	CLIP-seq
MIRT1022012	hsa-miR-3616-3p	CLIP-seq
MIRT1022013	hsa-miR-4520a-3p	CLIP-seq
MIRT1022014	hsa-miR-4520b-3p	CLIP-seq
MIRT1022015	hsa-miR-4640-3p	CLIP-seq
MIRT1022016	hsa-miR-4694-3p	CLIP-seq
MIRT1022017	hsa-miR-4697-3p	CLIP-seq
MIRT1022018	hsa-miR-4772-3p	CLIP-seq
MIRT1022019	hsa-miR-522	CLIP-seq
MIRT1022020	hsa-miR-552	CLIP-seq
MIRT1022021	hsa-miR-764	CLIP-seq
MIRT1022022	hsa-miR-802	CLIP-seq
MIRT1022023	hsa-miR-1183	CLIP-seq
MIRT1022024	hsa-miR-1303	CLIP-seq
MIRT1022025	hsa-miR-214	CLIP-seq
MIRT1022026	hsa-miR-25	CLIP-seq
MIRT1022027	hsa-miR-3145-5p	CLIP-seq
MIRT1022028	hsa-miR-3150b-3p	CLIP-seq
MIRT1022029	hsa-miR-32	CLIP-seq
MIRT1022030	hsa-miR-3619-5p	CLIP-seq
MIRT1022031	hsa-miR-363	CLIP-seq
MIRT1022032	hsa-miR-367	CLIP-seq
MIRT1022033	hsa-miR-4274	CLIP-seq
MIRT1022034	hsa-miR-4291	CLIP-seq
MIRT1022035	hsa-miR-4325	CLIP-seq
MIRT1022036	hsa-miR-4496	CLIP-seq
MIRT1022037	hsa-miR-4689	CLIP-seq
MIRT1022038	hsa-miR-4700-3p	CLIP-seq
MIRT1022039	hsa-miR-4784	CLIP-seq
MIRT1022040	hsa-miR-4802-3p	CLIP-seq
MIRT1022041	hsa-miR-761	CLIP-seq
MIRT1022042	hsa-miR-922	CLIP-seq
MIRT1022043	hsa-miR-92a	CLIP-seq
MIRT1022044	hsa-miR-92b	CLIP-seq
MIRT1022045	hsa-miR-1182	CLIP-seq
MIRT1022046	hsa-miR-1207-5p	CLIP-seq
MIRT1022047	hsa-miR-1224-3p	CLIP-seq
MIRT1022048	hsa-miR-1283	CLIP-seq
MIRT1022049	hsa-miR-140-5p	CLIP-seq
MIRT1022050	hsa-miR-1825	CLIP-seq
MIRT1022051	hsa-miR-186	CLIP-seq
MIRT1022052	hsa-miR-188-3p	CLIP-seq
MIRT1022053	hsa-miR-193a-5p	CLIP-seq
MIRT1022054	hsa-miR-199a-5p	CLIP-seq
MIRT1022055	hsa-miR-199b-5p	CLIP-seq
MIRT1022056	hsa-miR-2114	CLIP-seq
MIRT1022057	hsa-miR-2278	CLIP-seq
MIRT1022058	hsa-miR-3123	CLIP-seq
MIRT1022012	hsa-miR-3616-3p	CLIP-seq
MIRT1022059	hsa-miR-3676	CLIP-seq
MIRT1022060	hsa-miR-371b-3p	CLIP-seq
MIRT1022061	hsa-miR-3919	CLIP-seq
MIRT1022062	hsa-miR-3925-3p	CLIP-seq
MIRT1022063	hsa-miR-4286	CLIP-seq
MIRT1022064	hsa-miR-4436b-3p	CLIP-seq
MIRT1022065	hsa-miR-4468	CLIP-seq
MIRT1022066	hsa-miR-4512	CLIP-seq
MIRT1022067	hsa-miR-4540	CLIP-seq
MIRT1022068	hsa-miR-4659a-3p	CLIP-seq
MIRT1022069	hsa-miR-4659b-3p	CLIP-seq
MIRT1022070	hsa-miR-4667-3p	CLIP-seq
MIRT1022071	hsa-miR-4668-3p	CLIP-seq
MIRT1022072	hsa-miR-4719	CLIP-seq
MIRT1022073	hsa-miR-4721	CLIP-seq
MIRT1022074	hsa-miR-4755-3p	CLIP-seq
MIRT1022075	hsa-miR-4761-3p	CLIP-seq
MIRT1022076	hsa-miR-4761-5p	CLIP-seq
MIRT1022077	hsa-miR-4763-3p	CLIP-seq
MIRT1022078	hsa-miR-4778-3p	CLIP-seq
MIRT1022079	hsa-miR-488	CLIP-seq
MIRT1022080	hsa-miR-498	CLIP-seq
MIRT1022081	hsa-miR-515-5p	CLIP-seq
MIRT1022082	hsa-miR-520a-5p	CLIP-seq
MIRT1022083	hsa-miR-525-5p	CLIP-seq
MIRT1022084	hsa-miR-526b	CLIP-seq
MIRT1022085	hsa-miR-541	CLIP-seq
MIRT1022086	hsa-miR-554	CLIP-seq
MIRT1022087	hsa-miR-654-3p	CLIP-seq
MIRT1022088	hsa-miR-654-5p	CLIP-seq
MIRT1022089	hsa-miR-766	CLIP-seq
MIRT1556458	hsa-miR-548b-3p	CLIP-seq
MIRT2002846	hsa-miR-1207-3p	CLIP-seq
MIRT1022063	hsa-miR-4286	CLIP-seq
MIRT2002847	hsa-miR-4301	CLIP-seq
MIRT2002848	hsa-miR-451b	CLIP-seq
MIRT1022074	hsa-miR-4755-3p	CLIP-seq
MIRT1022075	hsa-miR-4761-3p	CLIP-seq
MIRT1022022	hsa-miR-802	CLIP-seq
MIRT1022059	hsa-miR-3676	CLIP-seq
MIRT2002849	hsa-miR-3915	CLIP-seq
MIRT2002850	hsa-miR-3928	CLIP-seq
MIRT2002851	hsa-miR-4328	CLIP-seq
MIRT1022076	hsa-miR-4761-5p	CLIP-seq
MIRT1022080	hsa-miR-498	CLIP-seq
MIRT1556458	hsa-miR-548b-3p	CLIP-seq
MIRT2002846	hsa-miR-1207-3p	CLIP-seq
MIRT1022052	hsa-miR-188-3p	CLIP-seq
MIRT1022056	hsa-miR-2114	CLIP-seq
MIRT2002848	hsa-miR-451b	CLIP-seq
MIRT2450420	hsa-miR-4786-5p	CLIP-seq
MIRT1022086	hsa-miR-554	CLIP-seq
MIRT2539725	hsa-let-7a	CLIP-seq
MIRT2539726	hsa-let-7b	CLIP-seq
MIRT2539727	hsa-let-7c	CLIP-seq
MIRT2539728	hsa-let-7d	CLIP-seq
MIRT2539729	hsa-let-7e	CLIP-seq
MIRT2539730	hsa-let-7f	CLIP-seq
MIRT2539731	hsa-let-7g	CLIP-seq
MIRT2539732	hsa-let-7i	CLIP-seq
MIRT2539733	hsa-miR-1	CLIP-seq
MIRT1022045	hsa-miR-1182	CLIP-seq
MIRT1022046	hsa-miR-1207-5p	CLIP-seq
MIRT1022047	hsa-miR-1224-3p	CLIP-seq
MIRT2539734	hsa-miR-1231	CLIP-seq
MIRT2539735	hsa-miR-1252	CLIP-seq
MIRT2539736	hsa-miR-127-5p	CLIP-seq
MIRT1022048	hsa-miR-1283	CLIP-seq
MIRT2539737	hsa-miR-1285	CLIP-seq
MIRT2539738	hsa-miR-143	CLIP-seq
MIRT2539739	hsa-miR-146b-3p	CLIP-seq
MIRT1022050	hsa-miR-1825	CLIP-seq
MIRT1022053	hsa-miR-193a-5p	CLIP-seq
MIRT1022054	hsa-miR-199a-5p	CLIP-seq
MIRT1022055	hsa-miR-199b-5p	CLIP-seq
MIRT2539740	hsa-miR-203	CLIP-seq
MIRT2539741	hsa-miR-204	CLIP-seq
MIRT2539742	hsa-miR-2052	CLIP-seq
MIRT2539743	hsa-miR-206	CLIP-seq
MIRT2539744	hsa-miR-211	CLIP-seq
MIRT1022025	hsa-miR-214	CLIP-seq
MIRT1022008	hsa-miR-223	CLIP-seq
MIRT1022057	hsa-miR-2278	CLIP-seq
MIRT2539745	hsa-miR-2467-3p	CLIP-seq
MIRT2539746	hsa-miR-3064-3p	CLIP-seq
MIRT2539747	hsa-miR-3127-3p	CLIP-seq
MIRT2539748	hsa-miR-3129-3p	CLIP-seq
MIRT2539749	hsa-miR-3140-3p	CLIP-seq
MIRT2539750	hsa-miR-3145-3p	CLIP-seq
MIRT2539751	hsa-miR-3163	CLIP-seq
MIRT2539752	hsa-miR-3170	CLIP-seq
MIRT2539753	hsa-miR-3187-5p	CLIP-seq
MIRT1022011	hsa-miR-323b-3p	CLIP-seq
MIRT2539754	hsa-miR-335	CLIP-seq
MIRT2539755	hsa-miR-339-5p	CLIP-seq
MIRT2539756	hsa-miR-340	CLIP-seq
MIRT2539757	hsa-miR-3529	CLIP-seq
MIRT2539758	hsa-miR-3607-3p	CLIP-seq
MIRT1022012	hsa-miR-3616-3p	CLIP-seq
MIRT2539759	hsa-miR-3617	CLIP-seq
MIRT1022030	hsa-miR-3619-5p	CLIP-seq
MIRT2539760	hsa-miR-3646	CLIP-seq
MIRT2539761	hsa-miR-3662	CLIP-seq
MIRT2539762	hsa-miR-3673	CLIP-seq
MIRT2539763	hsa-miR-3685	CLIP-seq
MIRT2539764	hsa-miR-3686	CLIP-seq
MIRT1022060	hsa-miR-371b-3p	CLIP-seq
MIRT2539765	hsa-miR-371b-5p	CLIP-seq
MIRT2539766	hsa-miR-379	CLIP-seq
MIRT2539767	hsa-miR-3913-3p	CLIP-seq
MIRT1022062	hsa-miR-3925-3p	CLIP-seq
MIRT2539768	hsa-miR-4257	CLIP-seq
MIRT1022033	hsa-miR-4274	CLIP-seq
MIRT2539769	hsa-miR-4279	CLIP-seq
MIRT2539770	hsa-miR-4282	CLIP-seq
MIRT2539771	hsa-miR-4288	CLIP-seq
MIRT1022034	hsa-miR-4291	CLIP-seq
MIRT2539772	hsa-miR-4424	CLIP-seq
MIRT1022064	hsa-miR-4436b-3p	CLIP-seq
MIRT2539773	hsa-miR-4451	CLIP-seq
MIRT2539774	hsa-miR-4458	CLIP-seq
MIRT1022065	hsa-miR-4468	CLIP-seq
MIRT2539775	hsa-miR-4500	CLIP-seq
MIRT1022066	hsa-miR-4512	CLIP-seq
MIRT2002848	hsa-miR-451b	CLIP-seq
MIRT1022015	hsa-miR-4640-3p	CLIP-seq
MIRT2539776	hsa-miR-4650-3p	CLIP-seq
MIRT1022071	hsa-miR-4668-3p	CLIP-seq
MIRT2539777	hsa-miR-4684-5p	CLIP-seq
MIRT2539778	hsa-miR-4691-5p	CLIP-seq
MIRT1022017	hsa-miR-4697-3p	CLIP-seq
MIRT2539779	hsa-miR-4698	CLIP-seq
MIRT2539780	hsa-miR-4717-3p	CLIP-seq
MIRT1022073	hsa-miR-4721	CLIP-seq
MIRT2539781	hsa-miR-4731-3p	CLIP-seq
MIRT2539782	hsa-miR-4733-5p	CLIP-seq
MIRT1022077	hsa-miR-4763-3p	CLIP-seq
MIRT2539783	hsa-miR-4775	CLIP-seq
MIRT2539784	hsa-miR-4778-5p	CLIP-seq
MIRT2539785	hsa-miR-4780	CLIP-seq
MIRT2539786	hsa-miR-4795-3p	CLIP-seq
MIRT2539787	hsa-miR-4801	CLIP-seq
MIRT1022040	hsa-miR-4802-3p	CLIP-seq
MIRT2539788	hsa-miR-495	CLIP-seq
MIRT2539789	hsa-miR-508-5p	CLIP-seq
MIRT1022081	hsa-miR-515-5p	CLIP-seq
MIRT1022082	hsa-miR-520a-5p	CLIP-seq
MIRT1022019	hsa-miR-522	CLIP-seq
MIRT1022083	hsa-miR-525-5p	CLIP-seq
MIRT1022084	hsa-miR-526b	CLIP-seq
MIRT1022085	hsa-miR-541	CLIP-seq
MIRT2539790	hsa-miR-548ad	CLIP-seq
MIRT1556458	hsa-miR-548b-3p	CLIP-seq
MIRT2539791	hsa-miR-548c-3p	CLIP-seq
MIRT2539792	hsa-miR-548m	CLIP-seq
MIRT2539793	hsa-miR-582-3p	CLIP-seq
MIRT2539794	hsa-miR-590-3p	CLIP-seq
MIRT2539795	hsa-miR-612	CLIP-seq
MIRT2539796	hsa-miR-613	CLIP-seq
MIRT2539797	hsa-miR-623	CLIP-seq
MIRT2539798	hsa-miR-628-3p	CLIP-seq
MIRT2539799	hsa-miR-629	CLIP-seq
MIRT2539800	hsa-miR-632	CLIP-seq
MIRT2539801	hsa-miR-641	CLIP-seq
MIRT1022088	hsa-miR-654-5p	CLIP-seq
MIRT1022041	hsa-miR-761	CLIP-seq
MIRT1022089	hsa-miR-766	CLIP-seq
MIRT1022022	hsa-miR-802	CLIP-seq
MIRT2539802	hsa-miR-888	CLIP-seq
MIRT2539803	hsa-miR-889	CLIP-seq
MIRT1022042	hsa-miR-922	CLIP-seq
MIRT2539804	hsa-miR-98	CLIP-seq
MIRT2539725	hsa-let-7a	CLIP-seq
MIRT2539726	hsa-let-7b	CLIP-seq
MIRT2539727	hsa-let-7c	CLIP-seq
MIRT2539728	hsa-let-7d	CLIP-seq
MIRT2539729	hsa-let-7e	CLIP-seq
MIRT2539730	hsa-let-7f	CLIP-seq
MIRT2539731	hsa-let-7g	CLIP-seq
MIRT2539732	hsa-let-7i	CLIP-seq
MIRT2539733	hsa-miR-1	CLIP-seq
MIRT1022045	hsa-miR-1182	CLIP-seq
MIRT1022046	hsa-miR-1207-5p	CLIP-seq
MIRT1022047	hsa-miR-1224-3p	CLIP-seq
MIRT2539734	hsa-miR-1231	CLIP-seq
MIRT2539735	hsa-miR-1252	CLIP-seq
MIRT2539736	hsa-miR-127-5p	CLIP-seq
MIRT1022048	hsa-miR-1283	CLIP-seq
MIRT2539737	hsa-miR-1285	CLIP-seq
MIRT1022049	hsa-miR-140-5p	CLIP-seq
MIRT2539738	hsa-miR-143	CLIP-seq
MIRT2539739	hsa-miR-146b-3p	CLIP-seq
MIRT1022050	hsa-miR-1825	CLIP-seq
MIRT1022053	hsa-miR-193a-5p	CLIP-seq
MIRT1022054	hsa-miR-199a-5p	CLIP-seq
MIRT1022055	hsa-miR-199b-5p	CLIP-seq
MIRT2539740	hsa-miR-203	CLIP-seq
MIRT2539741	hsa-miR-204	CLIP-seq
MIRT2539742	hsa-miR-2052	CLIP-seq
MIRT2539743	hsa-miR-206	CLIP-seq
MIRT2539744	hsa-miR-211	CLIP-seq
MIRT1022025	hsa-miR-214	CLIP-seq
MIRT1022057	hsa-miR-2278	CLIP-seq
MIRT2539745	hsa-miR-2467-3p	CLIP-seq
MIRT2539746	hsa-miR-3064-3p	CLIP-seq
MIRT2539748	hsa-miR-3129-3p	CLIP-seq
MIRT2539749	hsa-miR-3140-3p	CLIP-seq
MIRT2539750	hsa-miR-3145-3p	CLIP-seq
MIRT2539751	hsa-miR-3163	CLIP-seq
MIRT2539752	hsa-miR-3170	CLIP-seq
MIRT2539753	hsa-miR-3187-5p	CLIP-seq
MIRT2539754	hsa-miR-335	CLIP-seq
MIRT2539755	hsa-miR-339-5p	CLIP-seq
MIRT2539756	hsa-miR-340	CLIP-seq
MIRT2539757	hsa-miR-3529	CLIP-seq
MIRT2539758	hsa-miR-3607-3p	CLIP-seq
MIRT1022012	hsa-miR-3616-3p	CLIP-seq
MIRT2539759	hsa-miR-3617	CLIP-seq
MIRT1022030	hsa-miR-3619-5p	CLIP-seq
MIRT2539760	hsa-miR-3646	CLIP-seq
MIRT2539761	hsa-miR-3662	CLIP-seq
MIRT2539762	hsa-miR-3673	CLIP-seq
MIRT2539764	hsa-miR-3686	CLIP-seq
MIRT1022060	hsa-miR-371b-3p	CLIP-seq
MIRT2539765	hsa-miR-371b-5p	CLIP-seq
MIRT2539766	hsa-miR-379	CLIP-seq
MIRT2539767	hsa-miR-3913-3p	CLIP-seq
MIRT1022062	hsa-miR-3925-3p	CLIP-seq
MIRT2539768	hsa-miR-4257	CLIP-seq
MIRT1022033	hsa-miR-4274	CLIP-seq
MIRT2539769	hsa-miR-4279	CLIP-seq
MIRT2539770	hsa-miR-4282	CLIP-seq
MIRT2539771	hsa-miR-4288	CLIP-seq
MIRT1022034	hsa-miR-4291	CLIP-seq
MIRT1022064	hsa-miR-4436b-3p	CLIP-seq
MIRT2539773	hsa-miR-4451	CLIP-seq
MIRT2539774	hsa-miR-4458	CLIP-seq
MIRT1022065	hsa-miR-4468	CLIP-seq
MIRT2539775	hsa-miR-4500	CLIP-seq
MIRT1022066	hsa-miR-4512	CLIP-seq
MIRT2681668	hsa-miR-4519	CLIP-seq
MIRT2002848	hsa-miR-451b	CLIP-seq
MIRT2539776	hsa-miR-4650-3p	CLIP-seq
MIRT1022071	hsa-miR-4668-3p	CLIP-seq
MIRT2539777	hsa-miR-4684-5p	CLIP-seq
MIRT2539778	hsa-miR-4691-5p	CLIP-seq
MIRT1022016	hsa-miR-4694-3p	CLIP-seq
MIRT2539779	hsa-miR-4698	CLIP-seq
MIRT2539780	hsa-miR-4717-3p	CLIP-seq
MIRT1022073	hsa-miR-4721	CLIP-seq
MIRT2539781	hsa-miR-4731-3p	CLIP-seq
MIRT2539782	hsa-miR-4733-5p	CLIP-seq
MIRT1022077	hsa-miR-4763-3p	CLIP-seq
MIRT2539783	hsa-miR-4775	CLIP-seq
MIRT2539784	hsa-miR-4778-5p	CLIP-seq
MIRT2539785	hsa-miR-4780	CLIP-seq
MIRT2539786	hsa-miR-4795-3p	CLIP-seq
MIRT2539787	hsa-miR-4801	CLIP-seq
MIRT1022040	hsa-miR-4802-3p	CLIP-seq
MIRT2539788	hsa-miR-495	CLIP-seq
MIRT2539789	hsa-miR-508-5p	CLIP-seq
MIRT1022081	hsa-miR-515-5p	CLIP-seq
MIRT1022082	hsa-miR-520a-5p	CLIP-seq
MIRT1022019	hsa-miR-522	CLIP-seq
MIRT1022083	hsa-miR-525-5p	CLIP-seq
MIRT1022084	hsa-miR-526b	CLIP-seq
MIRT1022085	hsa-miR-541	CLIP-seq
MIRT2539790	hsa-miR-548ad	CLIP-seq
MIRT1556458	hsa-miR-548b-3p	CLIP-seq
MIRT2539791	hsa-miR-548c-3p	CLIP-seq
MIRT2539792	hsa-miR-548m	CLIP-seq
MIRT1022020	hsa-miR-552	CLIP-seq
MIRT2539793	hsa-miR-582-3p	CLIP-seq
MIRT2539794	hsa-miR-590-3p	CLIP-seq
MIRT2539795	hsa-miR-612	CLIP-seq
MIRT2539796	hsa-miR-613	CLIP-seq
MIRT2539797	hsa-miR-623	CLIP-seq
MIRT2539798	hsa-miR-628-3p	CLIP-seq
MIRT2539799	hsa-miR-629	CLIP-seq
MIRT2539800	hsa-miR-632	CLIP-seq
MIRT2539801	hsa-miR-641	CLIP-seq
MIRT1022088	hsa-miR-654-5p	CLIP-seq
MIRT2681669	hsa-miR-671-5p	CLIP-seq
MIRT1022041	hsa-miR-761	CLIP-seq
MIRT1022021	hsa-miR-764	CLIP-seq
MIRT1022089	hsa-miR-766	CLIP-seq
MIRT1022022	hsa-miR-802	CLIP-seq
MIRT2539802	hsa-miR-888	CLIP-seq
MIRT1022042	hsa-miR-922	CLIP-seq
MIRT2539804	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004356	Function	Glutamine synthetase activity	IBA
GO:0004356	Function	Glutamine synthetase activity	IDA	30158707, 36289327
GO:0004356	Function	Glutamine synthetase activity	IEA
GO:0005515	Function	Protein binding	IPI	21994455, 25910212, 30158707, 36289327
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	30158707, 36289327
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	30158707
GO:0005886	Component	Plasma membrane	IEA
GO:0006538	Process	L-glutamate catabolic process	TAS	21757002
GO:0006542	Process	Glutamine biosynthetic process	IBA
GO:0006542	Process	Glutamine biosynthetic process	IEA
GO:0006542	Process	Glutamine biosynthetic process	TAS	21757002
GO:0008283	Process	Cell population proliferation	IDA	18662667
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010594	Process	Regulation of endothelial cell migration	IDA	30158707
GO:0010594	Process	Regulation of endothelial cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0018345	Process	Protein palmitoylation	IDA	30158707
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IDA	30158707
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA
GO:0042254	Process	Ribosome biogenesis	IMP	26711351
GO:0042802	Function	Identical protein binding	IPI	16189514, 19447967, 21988832, 25416956, 25502805, 31515488
GO:0044297	Component	Cell body	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097275	Process	Intracellular ammonium homeostasis	IEA
GO:0097275	Process	Intracellular ammonium homeostasis	ISS
GO:0097386	Component	Glial cell projection	IEA
GO:1903670	Process	Regulation of sprouting angiogenesis	IDA	30158707
GO:1903670	Process	Regulation of sprouting angiogenesis	IEA
GO:1904749	Process	Regulation of protein localization to nucleolus	IMP	26711351

Other IDs

• MIM: 138290
• HGNC: 4341
• e!Ensembl: ENSG00000135821

Protein

• UniProt ID: P15104
• Protein name: Glutamine synthetase (GS) (EC 6.3.1.2) (Glutamate--ammonia ligase) (Palmitoyltransferase GLUL) (EC 2.3.1.225)
• Protein function: Glutamine synthetase that catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine (PubMed:16267323, PubMed:30158707, PubMed:36289327). Its role depends on tissue localization: in the brain, it regulates the levels of toxic a
• PDB: 2OJW, 2QC8, 7EVT, 8DNU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03951	Gln-synt_N	24 → 104	Glutamine synthetase, beta-Grasp domain	Domain
  PF00120	Gln-synt_C	110 → 361	Glutamine synthetase, catalytic domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in endothelial cells. {ECO:0000269|PubMed:30158707}.
• Sequence:

  MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
  NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI
  MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
  RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP
  KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
  TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL
  LNETGDEPFQYKN

• Sequence length: 373

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Congenital brain dysgenesis due to glutamine synthetase deficiency	Likely pathogenic; Pathogenic	rs1650080437, rs1650179029, rs80358214, rs80358215	RCV001353062 RCV001353063 RCV000017463 RCV000017464 RCV000022586	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Developmental and epileptic encephalopathy 116	Likely pathogenic; Pathogenic	rs1131691970	RCV004782761	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Developmental and epileptic encephalopathy, 16	Likely pathogenic; Pathogenic	rs1131691970, rs2525592797	RCV004526131 RCV004526259 RCV004540681 RCV004525945	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glutamine synthetase stabilization disorder	Likely pathogenic; Pathogenic	rs1131691970, rs2525592797	RCV003883693 RCV003885347 RCV003885348 RCV003884568	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASES, METABOLIC, INBORN	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY	—	ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 16	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY INFANTILE EPILEPTIC ENCEPHALOPATHY WITH SUPPRESSION BURSTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial prostate cancer	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLUL-related disorder	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glutamine related condition	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC ENCEPHALOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29512829		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	9745420		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	24746201, 28580885, 31189995		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	9745420		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	29642388		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26455863	Associate	★☆☆☆☆ Found in Text Mining only
Amino Acid Metabolism, Inborn Errors	Disorder of amino acid metabolism	BEFREE	25896882		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20060132		★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	26395743	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31665640		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21682567	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35667160	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28229923		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	17235515, 29356297		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	29356297	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10588452, 11289476, 1370298, 17956579, 29171140, 8897011		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36073000	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	18218004		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33491460	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18062818, 23384343	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29642388		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27791265, 30609375		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36619229, 39795937	Associate	★☆☆☆☆ Found in Text Mining only
Carbamoyl-Phosphate Synthase I Deficiency Disease	Carbamoyl Phosphate Synthase Deficiency	BEFREE	31255736		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18282277, 31832976		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11461082, 17275129, 18282277, 19101982, 22766792, 26107238, 27469330, 28662289, 29303508, 29512829, 29569872, 30176945, 31067445, 35187863, 37249521	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37531433	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	31665640		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25169573, 26395743, 28779365		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26395743	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21607540, 35667160	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Inborn Metabolic Diseases	Central Nervous System Inborn Metabolic Diseases	CTD_human_DG	16267323		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29462606		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	15571623	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	29642388		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25516669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cirrhosis	Cirrhosis	BEFREE	28937622, 31391527		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	15647480		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26455863	Associate	★☆☆☆☆ Found in Text Mining only
Combined molybdoflavoprotein enzyme deficiency	Combined molybdoflavoprotein enzyme deficiency	BEFREE	27106218		★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	16267323, 26836257		★☆☆☆☆ Found in Text Mining only
Congenital brain dysgenesis due to glutamine synthetase deficiency	Congenital brain dysgenesis due to glutamine synthetase deficiency	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25677913		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25677913		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25677913, 29304826, 32651240	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25677913, 29304826, 30787070		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	20802180	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	16230605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	16230605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	20386568	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	39985170	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14747289, 15756536, 16514546, 21412422, 22957706, 25169573, 27398945, 29577424, 30401898, 30787070, 8816973, 9353155		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14747289, 15756536, 16514546, 21412422, 22957706, 25169573, 27398945, 29409329, 29577424, 30401898, 30787070, 8816973, 9353155, 9475358		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	7913951	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	1370298, 21412422, 26631888, 29791073, 32882033, 36073000, 7913951, 8325989, 8423231	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25677913, 26395743, 34085602	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10588452, 10720050, 11522662, 1370298, 14747289, 15629156, 16514546, 17479437, 17956579, 18218004, 21412422, 22384267, 22957706, 23396399, 23548576, 26802570, 27398945, 27984020, 29171140, 29196783, 29577424, 29636076, 29791073, 7614998, 7657822, 7681990, 8423231, 8486775, 8816974, 8897011, 9208924, 9353155, 9727889		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	BEFREE	24601691		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25677913, 26395743, 28986401, 29441491, 30787070, 9475358		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	21412422		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	21412422	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	10336123, 11520315, 23410662, 27769717, 28775328, 29636076, 30022509, 30053506, 31178690		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23410662	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	23384343	Associate	★☆☆☆☆ Found in Text Mining only
EPILEPSY, PYRIDOXINE-DEPENDENT	Epilepsy	BEFREE	10908915, 9621518		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	23384343		★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	39985170	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29512829		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	39350187	Associate	★☆☆☆☆ Found in Text Mining only
Fulminant Hepatic Failure with Cerebral Edema	Fulminant Hepatic Failure With Cerebral Edema	CTD_human_DG	10564534		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	21829393	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23410662, 26047211, 26595383, 30716120		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23410662, 26047211	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23410662, 26047211, 26595383, 30716120		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23410662		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32782394	Associate	★☆☆☆☆ Found in Text Mining only
Glutamine deficiency, congenital	Congenital brain dysgenesis due to glutamine synthetase deficiency	BEFREE	16267323, 26836257		★☆☆☆☆ Found in Text Mining only
Glutamine deficiency, congenital	Congenital brain dysgenesis due to glutamine synthetase deficiency	CLINGEN_DG	16267323, 20140959, 21353613, 25870278, 30053506, 30440076, 5336023		★☆☆☆☆ Found in Text Mining only
Glutamine deficiency, congenital	Congenital brain dysgenesis due to glutamine synthetase deficiency	CTD_human_DG	16267323		★☆☆☆☆ Found in Text Mining only
Glutamine deficiency, congenital	Congenital brain dysgenesis due to glutamine synthetase deficiency	UNIPROT_DG	16267323		★☆☆☆☆ Found in Text Mining only
Glutamine deficiency, congenital	Congenital brain dysgenesis due to glutamine synthetase deficiency	ORPHANET_DG	16267323		★☆☆☆☆ Found in Text Mining only
Glutamine deficiency, congenital	Congenital brain dysgenesis due to glutamine synthetase deficiency	GENOMICS_ENGLAND_DG	21353613, 30158707		★☆☆☆☆ Found in Text Mining only
Glutamine deficiency, congenital	Congenital brain dysgenesis due to glutamine synthetase deficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	21829393		★☆☆☆☆ Found in Text Mining only
GRISCELLI SYNDROME, TYPE 2	Griscelli syndrome	BEFREE	30103455		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	18218004		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36254001	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Coma	Hepatic Coma	CTD_human_DG	10564534		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	CTD_human_DG	10564534		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	20583283	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Stupor	Hepatic Stupor	CTD_human_DG	10564534		★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	28061766	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19200579, 21237236, 23715166, 28277286		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	28277286, 34235580	Associate	★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	17663417, 22914605, 26961851, 27469330, 28280721, 29512829, 31047837, 31698521		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	28662289		★☆☆☆☆ Found in Text Mining only
Hyperammonemia	Hyperammonemia	Pubtator	26599579, 32888207	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31144240		★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29155306, 30031104		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	15647480		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30158707		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	22914614, 31832976		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	19951903		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	19951903	Inhibit	★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	29408991		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	39337639	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25697355, 33882633	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29512829		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31324362		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16964294, 17487939, 18282277, 19101982, 21457159, 21834755, 22914605, 22914614, 25072259, 25516669, 25668519, 25740822, 26311355, 26676820, 27469330, 28280721, 28488786, 28584302, 28881044, 29260280, 29303508, 29569872, 29651702, 31189995, 31652385, 31832976		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17197094		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28937622, 31391527		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	25318388		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	39868884	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	11549067, 17299991, 30214381		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22326218, 30713111, 30967480		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22326218		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23415275, 29441491		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27791265, 30609375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	7909780		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31324362		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30419950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25431095, 31182548		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29435734		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28813676, 29383096, 29463059, 29599338, 31067445, 31574293		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	16230605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	16230605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	30233323		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	16763901		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	18371075		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	BEFREE	15571623		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	15571623	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26395743, 33354250	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	28163071		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21237236, 21852960, 22914614, 27791265, 27984126, 28813676, 29435734, 29463059, 29617730, 29651702, 30597357, 30808861, 31189995, 31324362, 31574293		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21353613, 29636076		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28587465, 29463059		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28077733, 28937622		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29599338, 31817360		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29740359		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	20882379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	34085602	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oligodendroglioma	Oligodendroglioma	Pubtator	21682567, 29642388	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	29642388		★☆☆☆☆ Found in Text Mining only
Ornithine carbamoyltransferase deficiency	Ornithine Carbamoyltransferase Deficiency	BEFREE	29623395		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15736433		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34260142	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30419950		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15829994, 31204315		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	15829994		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25431095, 31182548		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25431095	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	21185888		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	29740359		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Diseases	Retinal Diseases	BEFREE	25169573		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30808861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	12526990, 15091314, 15647480, 16513879, 17303389, 19125103, 25315318, 27550734, 28073605, 31739114, 31780643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15647480, 17303389, 19125103, 21185888		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	32888207, 39985170	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	23990215		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29621117		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26631888	Associate	★☆☆☆☆ Found in Text Mining only
Spastic cerebral palsy	Spastic Cerebral Palsy	BEFREE	15571623		★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	28061766		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status epilepticus	Pubtator	37410995	Associate	★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	15571623, 29636076		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29435734		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37612301	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21607540, 26395743, 35667160	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	14681921		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	29642388		★☆☆☆☆ Found in Text Mining only