GLT1D1 (glycosyltransferase 1 domain containing 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 144423
• Gene name: Glycosyltransferase 1 domain containing 1
• Gene symbol: GLT1D1
• Synonyms (NCBI Gene): -
• Chromosome: 12
• Chromosome location: 12q24.33

miRNA Show/Hide all (66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1021576	hsa-miR-1266	CLIP-seq
MIRT1021577	hsa-miR-1298	CLIP-seq
MIRT1021578	hsa-miR-151-5p	CLIP-seq
MIRT1021579	hsa-miR-151b	CLIP-seq
MIRT1021580	hsa-miR-3131	CLIP-seq
MIRT1021581	hsa-miR-3186-3p	CLIP-seq
MIRT1021582	hsa-miR-3664-3p	CLIP-seq
MIRT1021583	hsa-miR-3689d	CLIP-seq
MIRT1021584	hsa-miR-3928	CLIP-seq
MIRT1021585	hsa-miR-4269	CLIP-seq
MIRT1021586	hsa-miR-4514	CLIP-seq
MIRT1021587	hsa-miR-4518	CLIP-seq
MIRT1021588	hsa-miR-4692	CLIP-seq
MIRT1021589	hsa-miR-4742-5p	CLIP-seq
MIRT1021590	hsa-miR-611	CLIP-seq
MIRT2235706	hsa-miR-3620	CLIP-seq
MIRT2235707	hsa-miR-3690	CLIP-seq
MIRT2235708	hsa-miR-4308	CLIP-seq
MIRT2235709	hsa-miR-711	CLIP-seq
MIRT2450378	hsa-miR-1193	CLIP-seq
MIRT2450379	hsa-miR-1255a	CLIP-seq
MIRT2450380	hsa-miR-1255b	CLIP-seq
MIRT2450381	hsa-miR-1972	CLIP-seq
MIRT2450382	hsa-miR-3180	CLIP-seq
MIRT2450383	hsa-miR-3180-3p	CLIP-seq
MIRT2450384	hsa-miR-3183	CLIP-seq
MIRT2450385	hsa-miR-3196	CLIP-seq
MIRT2450386	hsa-miR-3675-5p	CLIP-seq
MIRT2450387	hsa-miR-4477a	CLIP-seq
MIRT2450388	hsa-miR-4504	CLIP-seq
MIRT2450389	hsa-miR-4529-5p	CLIP-seq
MIRT2450390	hsa-miR-4723-3p	CLIP-seq
MIRT2450391	hsa-miR-4775	CLIP-seq
MIRT2450392	hsa-miR-4802-3p	CLIP-seq
MIRT2450393	hsa-miR-490-5p	CLIP-seq
MIRT2450394	hsa-miR-542-3p	CLIP-seq
MIRT2450395	hsa-miR-548ac	CLIP-seq
MIRT2450396	hsa-miR-548ae	CLIP-seq
MIRT2450397	hsa-miR-548aj	CLIP-seq
MIRT2450398	hsa-miR-548am	CLIP-seq
MIRT2450399	hsa-miR-548d-3p	CLIP-seq
MIRT2450400	hsa-miR-548x	CLIP-seq
MIRT2450401	hsa-miR-548z	CLIP-seq
MIRT2450402	hsa-miR-603	CLIP-seq
MIRT2450381	hsa-miR-1972	CLIP-seq
MIRT2450384	hsa-miR-3183	CLIP-seq
MIRT2450389	hsa-miR-4529-5p	CLIP-seq
MIRT2450390	hsa-miR-4723-3p	CLIP-seq
MIRT2539597	hsa-miR-138	CLIP-seq
MIRT2450381	hsa-miR-1972	CLIP-seq
MIRT2539598	hsa-miR-3064-5p	CLIP-seq
MIRT2539599	hsa-miR-3169	CLIP-seq
MIRT2450384	hsa-miR-3183	CLIP-seq
MIRT2539600	hsa-miR-3652	CLIP-seq
MIRT2539601	hsa-miR-4299	CLIP-seq
MIRT2539602	hsa-miR-4430	CLIP-seq
MIRT2539603	hsa-miR-4436a	CLIP-seq
MIRT2539604	hsa-miR-4505	CLIP-seq
MIRT2539605	hsa-miR-4515	CLIP-seq
MIRT2450389	hsa-miR-4529-5p	CLIP-seq
MIRT2450390	hsa-miR-4723-3p	CLIP-seq
MIRT2539606	hsa-miR-892b	CLIP-seq
MIRT2450381	hsa-miR-1972	CLIP-seq
MIRT2450384	hsa-miR-3183	CLIP-seq
MIRT2450389	hsa-miR-4529-5p	CLIP-seq
MIRT2450390	hsa-miR-4723-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005829	Component	Cytosol	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q96MS3
• Protein name: Glycosyltransferase 1 domain-containing protein 1 (EC 2.4.-.-)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00534	Glycos_transf_1	154 → 319	Glycosyl transferases group 1	Family

• Sequence:

  MRLLFLAVLRPHTGNAVTAQRVRAHLEAAGHVCVLKDAFDFESRSEIANLILAENCEAAL
  ALHLYRGGRLLQGHRIPFGVIFGGTDVNEDANQAEKNTVMGRVLEEARFAVAFTESMKEM
  AQAQWPHAKGKVYVQSQGIATTPNAAFNWNTFLQRSEINQSADNLHIFLLICGLRQVKDP
  LYLVDAFSAWHQEEPNVHLVIVGPEVDPVFTREVKAKVKRAAGVRLIGEMPQEDLHAVVK
  NCFAVVNSSVSEGMSAAILEAMDLEVPVLARNIPGNAAVVKHEVTGLLFSNPQEFVHLAK
  RLVSDPALEKEIVVNGREYVRMYHSWQVERDTYQQLIRKLEGSTED

• Sequence length: 346

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	29967481	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	GWASCAT_DG	26031901		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	23364394		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24904231	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29967481	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29967481, 30065249		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	29967481		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	35459784	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for GLT1D1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GLT1D1.