GLIPR1L1 (GLIPR1 like 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 256710
Gene name GLIPR1 like 1
Gene symbol GLIPR1L1
Synonyms (NCBI Gene)
ALKN2972PRO7434
Chromosome 12
Chromosome location 12q21.2
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2235527 hsa-miR-186 CLIP-seq
MIRT2235528 hsa-miR-3133 CLIP-seq
MIRT2235529 hsa-miR-3609 CLIP-seq
MIRT2235530 hsa-miR-4699-5p CLIP-seq
MIRT2235531 hsa-miR-520g CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0001669 Component Acrosomal vesicle ISS
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610395 28392 ENSG00000173401
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UWM5
Protein name GLIPR1-like protein 1
Protein function Required for optimal fertilization at the stage of sperm-oocyte fusion, plays a role in optimizing acrosome function, the translocation of IZUMO1 during the acrosome reaction and the fertilization process. Component of epididymosomes, one type o
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00188 CAP 38 → 171 Cysteine-rich secretory protein family Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis. {ECO:0000269|PubMed:16714093}.
Sequence 
MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIW
DKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNE
TQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANM
PPYVRGESCSLCSKEEKCVKNLCRTPQLIIPNQNPFLKPTGRAPQQTAFNPFSLGFLLLR
IF
Sequence length 242
Interactions View interactions

No strongly related genes found yet for GLIPR1L1.

No additional diseases found yet through genes similar to GLIPR1L1.