GKN3P (gastrokine 3, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100132413
Gene name Gastrokine 3, pseudogene
Gene symbol GKN3P
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0042127 Process Regulation of cell population proliferation IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 37701 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CG01
Protein name Gastrokine-3
Protein function May inhibit gastric epithelial cell proliferation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04089 BRICHOS 55 → 144 BRICHOS domain Domain
Sequence 
MKHLVASSILGVFVLTPSLAMMNIRFNHPLYGSFGTQIIHIGAFQGMVSIRDNNIFSEWD
GILDYKNALLVAKVFNKMACVLARMDKAVFPSLDDISKALDKQAFKYYPSTRGLTYTVLP
SWVKNLAQYGKPIKNMCRDDPTYFAQQQKEGTALAIDSNSCFEIQLLSFMGLFICGETPG
L
Sequence length 181
Interactions View interactions

No strongly related genes found yet for GKN3P.

No additional diseases found yet through genes similar to GKN3P.