GIMAP8 (GTPase, IMAP family member 8)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 155038
• Gene name: GTPase, IMAP family member 8
• Gene symbol: GIMAP8
• Synonyms (NCBI Gene): IAN-9, IAN6, IAN9, IANT
• Chromosome: 7
• Chromosome location: 7q36.1
• Summary: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 20

miRNA Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036429	hsa-miR-1226-3p	CLASH	23622248
MIRT1019017	hsa-miR-1302	CLIP-seq
MIRT1019018	hsa-miR-148a	CLIP-seq
MIRT1019019	hsa-miR-148b	CLIP-seq
MIRT1019020	hsa-miR-152	CLIP-seq
MIRT1019021	hsa-miR-1825	CLIP-seq
MIRT1019022	hsa-miR-1912	CLIP-seq
MIRT1019023	hsa-miR-3130-5p	CLIP-seq
MIRT1019024	hsa-miR-3164	CLIP-seq
MIRT1019025	hsa-miR-3180-5p	CLIP-seq
MIRT1019026	hsa-miR-3185	CLIP-seq
MIRT1019027	hsa-miR-3665	CLIP-seq
MIRT1019028	hsa-miR-4298	CLIP-seq
MIRT1019029	hsa-miR-4482	CLIP-seq
MIRT1019030	hsa-miR-4648	CLIP-seq
MIRT1019031	hsa-miR-4662a-3p	CLIP-seq
MIRT1019032	hsa-miR-4795-3p	CLIP-seq
MIRT1019033	hsa-miR-520a-5p	CLIP-seq
MIRT1019034	hsa-miR-525-5p	CLIP-seq
MIRT1019035	hsa-miR-657	CLIP-seq
MIRT2001717	hsa-miR-1246	CLIP-seq
MIRT2001718	hsa-miR-132	CLIP-seq
MIRT2001719	hsa-miR-212	CLIP-seq
MIRT2001720	hsa-miR-3156-3p	CLIP-seq
MIRT2001721	hsa-miR-455-3p	CLIP-seq
MIRT2001722	hsa-miR-4694-3p	CLIP-seq
MIRT2001723	hsa-miR-4716-5p	CLIP-seq
MIRT2001724	hsa-miR-522	CLIP-seq

Gene ontology (GO) Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0070232	Process	Regulation of T cell apoptotic process	IEA

Other IDs

• MIM: 616962
• HGNC: 21792
• e!Ensembl: ENSG00000171115

Protein

• UniProt ID: Q8ND71
• Protein name: GTPase IMAP family member 8 (Immune-associated nucleotide-binding protein 9) (IAN-9) (Protein IanT)
• Protein function: Exerts an anti-apoptotic effect in the immune system and is involved in responses to infections.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04548	AIG1	439 → 655	AIG1 family	Domain
  PF04548	AIG1	11 → 220	AIG1 family	Domain
  PF04548	AIG1	248 → 437	AIG1 family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the spleen, intestine, liver, and colon, as well as in lung, placenta, kidney, muscle, and heart. Extremely low expression, if any, in brain, in thymus, bone marrow, and blood leukocytes (PubMed:15474311). Detected in T-ce
• Sequence:

  MSEQSCQMSELRLLLLGKCRSGKSATGNAILGKHVFKSKFSDQTVIKMCQRESWVLRERK
  VVVIDTPDLFSSIACAEDKQRNIQHCLELSAPSLHALLLVIAIGHFTREDEETAKGIQQV
  FGAEARRHIIIVFTRKDDLGDDLLQDFIEKNKPLKQLVQDYEGRYCIFNNKTNSKDEQIT
  QVLELLRKVESLVNTNGGPYHVNFKTEGSRFQDCVNEAASQEGDKPQGPRERQLQSTGPE
  QNPGTSELTVLLVGKRGAGKSAAGNSILGRQAFQTGFSEQSVTQSFLSESRSWRKKKVSI
  IDAPDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTKNDEAVLSTIQNNFGEKFFEYMI
  ILLTRKEDLGDQDLDTFLRNSNKALYGLIQKCKNRYSAFNYRATGEEEQRQADELLEKIE
  SMVHQNGNKHCVFREKETLNIVLVGRSGTGKSATGNSILGSLVFTSRLRAQPVTKTSQSG
  RRTWDGQEVVVVDTPSFNQMLDVEKDPSRLEEEVKRCLSCCEKGDTFFVLVFQLGRFTEE
  DKTAVAKLEAIFGADFTKYAIMLFTRKEDLGAGNLEDFMKNSDNKALRRIFKKCGRRVCA
  FNNKETGQAQETQVKALLTKVNDLRKESGWSGYPHTQENVSKLIKNVQEMSQAEKLLKNL
  IGILQ

• Sequence length: 665

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	32523132	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	32523132	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32410228	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18462827		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for GIMAP8.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GIMAP8.