GIMAP7 (GTPase, IMAP family member 7)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 168537
Gene name GTPase, IMAP family member 7
Gene symbol GIMAP7
Synonyms (NCBI Gene)
IAN7hIAN7
Chromosome 7
Chromosome location 7q36.1
Summary This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 20
miRNA miRNA information provided by mirtarbase database.
13 Show/Hide all (13)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT551428 hsa-miR-5011-5p PAR-CLIP 21572407
MIRT551427 hsa-miR-223-5p PAR-CLIP 21572407
MIRT551425 hsa-miR-6867-5p PAR-CLIP 21572407
MIRT551426 hsa-miR-190a-3p PAR-CLIP 21572407
MIRT551424 hsa-miR-513b-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IDA 23454188
GO:0005515 Function Protein binding IPI 23454188
GO:0005525 Function GTP binding IDA 23454188
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616961 22404 ENSG00000179144
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHV1
Protein name GTPase IMAP family member 7 (Immunity-associated nucleotide 7 protein) (IAN-7)
Protein function The dimer has GTPase activity; the active site contains residues from both subunits.
PDB 3ZJC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04548 AIG1 9 → 221 AIG1 family Domain
Tissue specificity TISSUE SPECIFICITY: Most abundantly expressed in spleen, lymph nodes, and fetal kidney, but also present in the heart and the small intestine. Lower expression levels are found in lung, kidney, liver, and thyroid, salivary, and mammary glands. Also detect
Sequence 
MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLL
VVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFG
KSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKES
QVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKH
KSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS
Sequence length 300
Interactions View interactions

No strongly related genes found yet for GIMAP7.

No additional diseases found yet through genes similar to GIMAP7.