GGTLC3 (gamma-glutamyltransferase light chain family member 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 728226
Gene name Gamma-glutamyltransferase light chain family member 3
Gene symbol GGTLC3
Synonyms (NCBI Gene)
GGT
Chromosome 22
Chromosome location 22q11.21
Summary Gamma-glutamyltransferase-1 (GGT1; MIM 612346) is a membrane-bound extracellular enzyme that cleaves gamma-glutamyl peptide bonds in glutathione and other peptides and transfers the gamma-glutamyl moiety to acceptors. Autocatalytic cleavage of the GGT1 pr
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0006751 Process Glutathione catabolic process IEA
GO:0036374 Function Glutathione hydrolase activity IEA
GO:0070062 Component Extracellular exosome HDA 23533145
GO:1901750 Process Leukotriene D4 biosynthetic process ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612340 33426 ENSG00000274252
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B5MD39
Protein name Glutathione hydrolase light chain 3 (Gamma-glutamyltransferase light chain 3)
Protein function Likely to be catalytically inactive.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01019 G_glu_transpept 1 → 220 Domain
Sequence 
MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYF
GSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQ
VRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVT
AALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
Sequence length 225
Interactions View interactions

No strongly related genes found yet for GGTLC3.

No additional diseases found yet through genes similar to GGTLC3.