GGTLC2 (gamma-glutamyltransferase light chain 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 91227
Gene name Gamma-glutamyltransferase light chain 2
Gene symbol GGTLC2
Synonyms (NCBI Gene)
GGTL4
Chromosome 22
Chromosome location 22q11.22
Summary This gene encodes a protein related to enzymes that cleaves gamma-glutamyl peptide bonds in glutathione and other peptides. Unlike similar proteins, the encoded protein contains only the light chain portion and may not have catalytic activity. Alternative
miRNA miRNA information provided by mirtarbase database.
11 Show/Hide all (11)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1018369 hsa-miR-1207-5p CLIP-seq
MIRT1018370 hsa-miR-1321 CLIP-seq
MIRT1018371 hsa-miR-4254 CLIP-seq
MIRT1018372 hsa-miR-4270 CLIP-seq
MIRT1018373 hsa-miR-4436b-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0006751 Process Glutathione catabolic process IEA
GO:0036374 Function Glutathione hydrolase activity IEA
GO:0070062 Component Extracellular exosome HDA 23533145
GO:1901750 Process Leukotriene D4 biosynthetic process ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612339 18596 ENSG00000100121
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14390
Protein name Glutathione hydrolase light chain 2 (Gamma-glutamyltransferase light chain 2) (Gamma-glutamyltransferase-like protein 4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01019 G_glu_transpept 1 → 213 Domain
Tissue specificity TISSUE SPECIFICITY: Placenta and sigmoid tissues.
Sequence 
MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYF
GSKVRSPVSEILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQ
PPSHADHTPMPQAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRH
HHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
Sequence length 218
Interactions View interactions

No strongly related genes found yet for GGTLC2.

No additional diseases found yet through genes similar to GGTLC2.