GGTLC1 (gamma-glutamyltransferase light chain 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 92086
Gene name Gamma-glutamyltransferase light chain 1
Gene symbol GGTLC1
Synonyms (NCBI Gene)
GGTL6GGTLA3GGTLA4dJ831C21.1dJ831C21.2
Chromosome 20
Chromosome location 20p11.21
Summary This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translational
miRNA miRNA information provided by mirtarbase database.
9 Show/Hide all (9)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1018360 hsa-miR-1321 CLIP-seq
MIRT1018361 hsa-miR-1972 CLIP-seq
MIRT1018362 hsa-miR-4254 CLIP-seq
MIRT1018363 hsa-miR-4270 CLIP-seq
MIRT1018364 hsa-miR-4441 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0006751 Process Glutathione catabolic process IEA
GO:0036374 Function Glutathione hydrolase activity IEA
GO:1901750 Process Leukotriene D4 biosynthetic process ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612338 16437 ENSG00000149435
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BX51
Protein name Glutathione hydrolase light chain 1 (Gamma-glutamyltransferase light chain 1) (Gamma-glutamyltransferase-like activity 4) (Gamma-glutamyltransferase-like protein 6)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01019 G_glu_transpept 1 → 220 Domain
Sequence 
MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYF
GSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQ
VRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVT
AALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Sequence length 225
Interactions View interactions

No strongly related genes found yet for GGTLC1.

No additional diseases found yet through genes similar to GGTLC1.