Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54857
Gene name	Glycerophosphodiester phosphodiesterase domain containing 2
Gene symbol	GDPD2
Synonyms (NCBI Gene)	GDE3OBDPF
Chromosome	X
Chromosome location	Xq13.1
Summary	This gene encodes a member of the glycerophosphodiester phosphodiesterase enzyme family. The encoded protein hydrolyzes glycerophosphoinositol to produce inositol 1-phosphate and glycerol. This protein may have a role in osteoblast differentiation and gro

12 Show/Hide all (12)

miRTarBase ID	miRNA	Experiments
MIRT1016046	hsa-miR-204	CLIP-seq
MIRT1016047	hsa-miR-211	CLIP-seq
MIRT1016048	hsa-miR-3682-5p	CLIP-seq
MIRT1016049	hsa-miR-4287	CLIP-seq
MIRT1016050	hsa-miR-4469	CLIP-seq
MIRT1016051	hsa-miR-4685-3p	CLIP-seq
MIRT1016046	hsa-miR-204	CLIP-seq
MIRT1016047	hsa-miR-211	CLIP-seq
MIRT1016048	hsa-miR-3682-5p	CLIP-seq
MIRT1016049	hsa-miR-4287	CLIP-seq
MIRT1016050	hsa-miR-4469	CLIP-seq
MIRT1016051	hsa-miR-4685-3p	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0008889	Function	Glycerophosphodiester phosphodiesterase activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047394	Function	Glycerophosphoinositol inositolphosphodiesterase activity	IEA

MIM	HGNC	e!Ensembl
300940	25974	ENSG00000130055

Q9HCC8

Protein name

Glycerophosphoinositol inositolphosphodiesterase GDPD2 (EC 3.1.4.43) (Glycerophosphodiester phosphodiesterase 3) (Glycerophosphodiester phosphodiesterase domain-containing protein 2) (Osteoblast differentiation promoting factor)

Protein function

Has glycerophosphoinositol inositolphosphodiesterase activity and specifically hydrolyzes glycerophosphoinositol, with no activity for other substrates such as glycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03009	GDPD	229 → 389	Glycerophosphoryl diester phosphodiesterase family	Family

Sequence

MAESPGCCSVWARCLHCLYSCHWRKCPRERMQTSKCDCIWFGLLFLTFLLSLSWLYIGLV
LLNDLHNFNEFLFRRWGHWMDWSLAFLLVISLLVTYASLLLVLALLLRLCRQPLHLHSLH
KVLLLLIMLLVAAGLVGLDIQWQQEWHSLRVSLQATAPFLHIGAAAGIALLAWPVADTFY
RIHRRGPKILLLLLFFGVVLVIYLAPLCISSPCIMEPRDLPPKPGLVGHRGAPMLAPENT
LMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTNVASVFPTRITAHSSDFSWTE
LKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLEEAAALNLSIMFDLRRPP
QNHTYYDTFVIQTLETVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERP
QFLNLPYQDLPLLDIKALHKDNVSVNLFVVNKPWLFSLLWCAGVDSVTTNDCQLLQQMRY
PIWLITPQTYLIIWVITNCVSTMLLLWTFLLQRRFVKKRGKTGLETAVLLTRINNFMME

Sequence length

539

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	28849762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	33982443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28849762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28849762		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with GDPD2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for GDPD2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to GDPD2 (see Related Genes above), that are NOT already directly curated for GDPD2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to GDPD2.

GDPD2 (glycerophosphodiester phosphodiesterase domain containing 2)

Save This Analysis