GCSAM (germinal center associated signaling and motility)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 257144
• Gene name: Germinal center associated signaling and motility
• Gene symbol: GCSAM
• Synonyms (NCBI Gene): GCAT2, GCET2, HGAL
• Chromosome: 3
• Chromosome location: 3q13.2
• Summary: This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two pu

miRNA Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006285	hsa-miR-155-5p	Luciferase reporter assay, Western blot	22096245
MIRT006285	hsa-miR-155-5p	Luciferase reporter assay, Western blot	22096245
MIRT006285	hsa-miR-155-5p	Luciferase reporter assay, Western blot	22096245
MIRT440582	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT440582	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT727596	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT727597	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT727595	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727594	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727593	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727592	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727591	hsa-miR-30e-5p	HITS-CLIP	22473208

Transcription factors

Transcription factor	Regulation	Reference
PRDM1	Repression	21722313

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IPI	17823310
GO:0005515	Function	Protein binding	IPI	20844236, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	23299888
GO:0045159	Function	Myosin II binding	IPI	17823310
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IBA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IEA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IMP	23299888
GO:2000401	Process	Regulation of lymphocyte migration	IEA
GO:2000402	Process	Negative regulation of lymphocyte migration	IBA
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	17823310

Other IDs

• MIM: 607792
• HGNC: 20253
• e!Ensembl: ENSG00000174500

Protein

• UniProt ID: Q8N6F7
• Protein name: Germinal center-associated signaling and motility protein (Germinal center B-cell-expressed transcript 2 protein) (Germinal center-associated lymphoma protein) (hGAL)
• Protein function: Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15666	HGAL	65 → 153	Germinal center-associated lymphoma	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen. {EC
• Sequence:

  MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDS
  QNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRES
  LGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL

• Sequence length: 178

Related Genes

No strongly related genes found yet for GCSAM.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GCSAM.