GCRG224 (-)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 360219 |
| Gene name | - |
| Gene symbol | GCRG224 |
| Synonyms (NCBI Gene) |
GCRG-P224
|
| Chromosome | 11 |
| Chromosome location | 11q14.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8WZA8 |
| Protein name | Putative gastric cancer-related gene 224 protein (GCRG-224) (GCRG-p224) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in gastric mucosa. {ECO:0000269|PubMed:12508346}. |
| Sequence |
MIPGNPSPGADLAVSKHFFSLSWFCGLLLLESKQK |
| Sequence length | 35 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with GCRG224 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to GCRG224 (see Related Genes above), that are NOT already directly curated for GCRG224 itself -- a lead worth checking, not a confirmed association.
0
|
|