GCHFR (GTP cyclohydrolase I feedback regulator)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 2644
• Gene name: GTP cyclohydrolase I feedback regulator
• Gene symbol: GCHFR
• Synonyms (NCBI Gene): GFRP, HsT16933, P35
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048942	hsa-miR-92a-3p	CLASH	23622248
MIRT2233947	hsa-miR-2276	CLIP-seq
MIRT2233948	hsa-miR-3127-5p	CLIP-seq
MIRT2233949	hsa-miR-342-5p	CLIP-seq
MIRT2233950	hsa-miR-3689d	CLIP-seq
MIRT2233951	hsa-miR-3918	CLIP-seq
MIRT2233952	hsa-miR-4310	CLIP-seq
MIRT2233953	hsa-miR-432	CLIP-seq
MIRT2233954	hsa-miR-4443	CLIP-seq
MIRT2233955	hsa-miR-4664-5p	CLIP-seq
MIRT2233956	hsa-miR-4749-3p	CLIP-seq
MIRT2233957	hsa-miR-4772-3p	CLIP-seq
MIRT2537879	hsa-miR-296-5p	CLIP-seq
MIRT2537880	hsa-miR-4260	CLIP-seq
MIRT2537881	hsa-miR-4283	CLIP-seq
MIRT2537882	hsa-miR-4420	CLIP-seq
MIRT2537883	hsa-miR-4489	CLIP-seq
MIRT2537884	hsa-miR-4492	CLIP-seq
MIRT2537885	hsa-miR-4498	CLIP-seq
MIRT2537886	hsa-miR-4505	CLIP-seq
MIRT2537887	hsa-miR-762	CLIP-seq
MIRT2537888	hsa-miR-938	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	9092499, 16696853
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16778797
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16778797
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0009890	Process	Negative regulation of biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IDA	16778797
GO:0031965	Component	Nuclear membrane	IDA	16778797
GO:0031965	Component	Nuclear membrane	IEA
GO:0042470	Component	Melanosome	IDA	16778797
GO:0044549	Function	GTP cyclohydrolase binding	IBA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	TAS	8702680
GO:0060308	Function	GTP cyclohydrolase I regulator activity	IEA
GO:0062014	Process	Negative regulation of small molecule metabolic process	IEA

Other IDs

• MIM: 602437
• HGNC: 4194
• e!Ensembl: ENSG00000137880

Protein

• UniProt ID: P30047
• Protein name: GTP cyclohydrolase 1 feedback regulatory protein (GFRP) (GTP cyclohydrolase I feedback regulatory protein) (p35)
• Protein function: Mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase 1. This inhibition is reversed by L-phenylalanine.
• PDB: 6Z80 , 6Z85 , 7ACC , 7AL9 , 7ALA , 7ALB , 7ALC , 7ALQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06399	GFRP	2 → 84	GTP cyclohydrolase I feedback regulatory protein (GFRP)	Domain

• Tissue specificity: TISSUE SPECIFICITY: In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level). {ECO:0000269|PubMed:16778797}.
• Sequence:

  MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKL
  ERRGFRVLSMTGVGQTLVWCLHKE

• Sequence length: 84

Pathways

Reactome Pathway:

Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation

Related Genes

No strongly related genes found yet for GCHFR.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to GCHFR.